Recombinant Dictyostelium discoideum ABC transporter G family member 4 (abcG4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
abcG4; DDB_G0289657; ABC transporter G family member 4; ABC transporter ABCG.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-798
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
abcG4
Target Protein Sequence
MEDIGNNNFEIIDDKSDEKNDENFEDKNSRNNINEEQILSNQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQEQQQFKNEVINTLHPKQPNNEYSLSSLSLSPQTPQINLSEKLISDNSNL NSNSNNNNKDIESGIQTKIKNIENRRNSINSDSSGTFNNEITNGRSNDNEIININNNVGV QVTFENICYKVLNKKYNEQKKIIKKLESGKIDIEDIESQVNKLPIDRIIEKELTILSNVS GIVEKGEMVALMGPSGSGKSTLLDILANRKSTGTITGKILVNGKEIGEAYKMFCSYVTQE EVFLETSTVYETLKFHADLRLPDMTDTEKDIRIKQVLKDVGLDRKLNSKIGGILPGGMIV KGLSGGEKKRVSIGCALVTNPSLLFLDEPTSGLDSLNSLKVMKVLLELTKMKGVTVVCSV HQPRPEIFYLFSNIMVVLKGRMVYSGSNILEYLSSIDSNYKCPPQMNPADFILDVCDEIV NNPSQYSTTVDTWEKYWKHEIQPTISNDPINIDIPKRVGFIYQYWVCQKRSYQSFVRNRV VFFSKIVIAILIGLLFSACFGTVGYDGLDQNEAQSVSALFFFIITSLNLLPYSSISTFVS IRTLFNSERASKIYHPFPYFIGSMLIEIVSSFFVVLIITTIIYCIVHLRWSFEAYILSLI SFYMVFLASVFMVIAMSNIAGTVDLTFSYCTGVSVVLVLFSGFLVPINSLPDSFGWIHHI DYLFYGFSSIVIIQYRDFEFQCPQPPIPCLYSNGNNLIEFLGLKNWEYNKSIGILTIWIA FFYILAYIGLYKFNKEKR
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of ABCG4 in Dictyostelium discoideum?

ABCG4 belongs to the ABCG family of ATP-binding cassette transporters in Dictyostelium discoideum. This family is characterized by a distinct domain organization where the ATP-binding cassette (ABC) domain precedes the transmembrane (TM) domain, unlike other ABC transporter families. In Dictyostelium, the ABCG family includes both half-transporters (with one ABC-TM unit) and full transporters (with two ABC-TM units) . The protein contains the conserved LSGG sequence between the Walker A and B motifs of the ATP-binding site, which is characteristic of all ABC transporters .

How does Dictyostelium ABCG4 differ from ABCG4 in other organisms?

Dictyostelium ABCG4 represents an evolutionary distinct member of the ABCG family. While animals predominantly express ABCG half-transporters, fungi exclusively have full transporters with two ABC-TM units. Dictyostelium, like plants, possesses both types . This suggests that Dictyostelium retained and expanded both forms of ABCG transporters from the common ancestor of crown organisms, while other lineages selectively retained specific forms. This evolutionary pattern provides unique research opportunities for understanding functional adaptations of ABCG transporters across eukaryotes .

What are the standard methods for expressing recombinant Dictyostelium ABCG4?

Recombinant expression of Dictyostelium ABCG4 can be achieved through multiple approaches:

Expression Systems:

  • Hybridoma sequencing approach: This involves sequencing antibodies from hybridoma cell lines that produce antibodies against Dictyostelium antigens, then using these sequences to produce recombinant antibodies that can target ABCG4 .

  • Phage display technology: This allows for selection of specific antibody fragments that recognize ABCG4, which can then be expressed recombinantly .

Expression Protocol:

  • Clone the ABCG4 gene from Dictyostelium genomic DNA or cDNA

  • Insert into an appropriate expression vector containing:

    • Inducible promoter

    • Purification tag (His, GST, etc.)

    • Signal sequences if secretion is desired

  • Transform into expression host (E. coli, yeast, insect cells, or mammalian cells)

  • Induce expression and purify using affinity chromatography

  • Verify protein identity and integrity using Western blotting with anti-ABCG4 antibodies

This recombinant approach ensures consistent supply of ABCG4 protein or antibodies against it for various research applications .

How can I design experiments to investigate the substrate specificity of Dictyostelium ABCG4?

Determining substrate specificity of Dictyostelium ABCG4 requires a multi-faceted experimental approach:

Methodology 1: Vesicular Transport Assays

  • Prepare membrane vesicles from cells overexpressing ABCG4

  • Incubate vesicles with potential radiolabeled substrates

  • Measure ATP-dependent accumulation inside vesicles

  • Compare with control vesicles lacking ABCG4 expression

Methodology 2: Knockout/Knockdown Studies

  • Generate ABCG4 knockout or knockdown Dictyostelium strains

  • Challenge cells with potential substrates

  • Measure accumulation/efflux compared to wild-type cells

  • Perform rescue experiments with recombinant ABCG4 to confirm specificity

Methodology 3: Direct Binding Assays

  • Purify recombinant ABCG4 protein

  • Perform binding assays with fluorescently labeled potential substrates

  • Measure binding parameters (Kd, Bmax) using fluorescence spectroscopy

  • Verify specificity through competition assays

Based on studies of ABCG4 in other organisms, potential substrates to test include cholesterol and its derivatives, as ABCG4 has been implicated in cholesterol transport in mammalian systems .

What are the methodological challenges in studying ABCG4 function in Dictyostelium compared to mammalian systems?

Studying ABCG4 in Dictyostelium presents several methodological challenges compared to mammalian systems:

ChallengeDictyostelium SystemMammalian SystemStrategic Approach
Membrane protein expressionLower expression levels in native stateOften higher expression in certain tissuesUse inducible overexpression systems specific for Dictyostelium
Post-translational modificationsDifferent glycosylation patternsWell-characterized modificationsCompare protein mobility on gels; use mass spectrometry to identify modifications
Functional assaysLimited established assaysWell-established transport assaysAdapt mammalian assays for Dictyostelium; develop novel microscopy-based approaches
Antibody availabilityLimited commercial reagentsWider range availableGenerate recombinant antibodies using phage display or hybridoma sequencing
Physiological relevanceDifferent cellular environmentDirect disease relevanceEstablish correlation between Dictyostelium and mammalian functions through complementation studies

The complexity of membrane protein purification and reconstitution remains a significant challenge in both systems, requiring detergent optimization and careful handling to maintain protein function .

How does the absence of ABCG4 affect cellular cholesterol homeostasis in Dictyostelium, and what methodologies can detect these changes?

Based on data from other systems, ABCG4 potentially plays a role in cellular cholesterol homeostasis. To investigate this in Dictyostelium:

Methodological Approach:

  • Generate ABCG4 knockout strains:

    • Use CRISPR-Cas9 or homologous recombination

    • Verify knockout by PCR, Western blotting

  • Quantitative cholesterol measurements:

    • Extract total cellular lipids using chloroform/methanol extraction

    • Quantify free cholesterol using enzymatic assays or mass spectrometry

    • Measure cholesterol esters separately to assess storage forms

  • Subcellular distribution analysis:

    • Use filipin staining to visualize free cholesterol by fluorescence microscopy

    • Perform subcellular fractionation followed by cholesterol quantification

    • Compare distribution patterns between wild-type and ABCG4-deficient cells

  • Functional assays:

    • Measure cholesterol efflux rates using radiolabeled cholesterol

    • Assess uptake of fluorescently labeled cholesterol analogs

    • Monitor membrane fluidity changes using fluorescence anisotropy

Findings from mammalian studies suggest ABCG4 contributes to cholesterol efflux and may influence cholesterol distribution within cellular compartments . Similar functions may exist in Dictyostelium, though the physiological context would differ due to the unique aspects of this model organism's biology.

How can I reconcile contradictory data regarding ABCG4 function between Dictyostelium and mammalian models?

Resolving contradictory data between Dictyostelium and mammalian ABCG4 studies requires systematic comparative analysis:

Resolution Strategy:

  • Sequence-function correlation analysis:

    • Perform detailed sequence alignments of Dictyostelium and mammalian ABCG4

    • Identify conserved and divergent domains

    • Correlate functional differences with sequence divergence

    • Create chimeric proteins to test domain-specific functions

  • Heterologous expression studies:

    • Express Dictyostelium ABCG4 in mammalian cells lacking endogenous ABCG4

    • Test functional complementation

    • Express mammalian ABCG4 in Dictyostelium ABCG4-knockout cells

    • Assess restoration of phenotypes

  • Evolutionary context analysis:

    • Consider that Dictyostelium's ABCG family contains both half and full transporters, unlike mammals

    • Analyze if functional differences correlate with evolutionary adaptations

    • Compare with other model organisms (yeast, plants) to establish evolutionary patterns

  • Cellular environment considerations:

    • Examine membrane composition differences between systems

    • Assess protein interaction partners unique to each system

    • Investigate regulatory mechanisms that may differ between organisms

For example, while mammalian ABCG4 has been implicated in Alzheimer's disease through potential roles in Aβ export and inhibition of γ-secretase activity , the Dictyostelium ortholog may have adapted to different physiological roles due to the absence of these specific pathways in the amoeba.

What is the optimal protocol for generating functional recombinant ABCG4 from Dictyostelium for in vitro studies?

Generating functional recombinant ABCG4 from Dictyostelium requires careful optimization at each step:

Comprehensive Protocol:

  • Gene optimization and vector design:

    • Optimize codon usage for expression system

    • Include purification tags (N-terminal or C-terminal depending on topology predictions)

    • Consider adding stabilizing fusion partners (MBP, SUMO)

    • Design construct with TEV protease site for tag removal

  • Expression system selection:

    • For functional studies: Insect cells (Sf9, High Five) often yield functional membrane proteins

    • For structural studies: Yeast (P. pastoris) can provide higher yields

    • For antibody production: E. coli expression of soluble domains

  • Expression optimization:

    • Test multiple induction temperatures (18-30°C)

    • Optimize induction duration (24-72 hours)

    • Screen different detergents for solubilization:

      Detergent ClassExamplesBest For
      Mild non-ionicDDM, LMNGMaintaining function
      Facial amphiphilesCHAPS, Fos-cholineEfficient extraction
      Styrene maleic acidSMA copolymerNative-like lipid environment
  • Purification strategy:

    • Two-step purification: affinity chromatography followed by size exclusion

    • Include cholesterol or lipid additives in all buffers

    • Maintain protein at 4°C throughout purification

    • Verify purity by SDS-PAGE and identity by mass spectrometry

  • Functional verification:

    • ATPase activity assays to confirm enzymatic function

    • Reconstitution into proteoliposomes for transport assays

    • Thermal stability assays (differential scanning fluorimetry)

This optimized protocol addresses the challenges of membrane protein expression while maximizing the likelihood of obtaining functional protein for downstream applications.

How can I establish a reliable assay system to measure ABCG4 transport activity in Dictyostelium?

Establishing a reliable transport assay for ABCG4 in Dictyostelium requires multiple complementary approaches:

In Vivo Transport Assays:

  • Direct cellular transport measurements:

    • Culture wild-type and ABCG4-knockout Dictyostelium cells

    • Load cells with fluorescent or radiolabeled substrates

    • Measure efflux/accumulation kinetics over time

    • Include ATP depletion controls (sodium azide treatment)

  • Fluorescence-based real-time imaging:

    • Express ABCG4 fused to GFP in Dictyostelium

    • Use fluorescent substrate analogs (BODIPY-cholesterol)

    • Perform live-cell confocal microscopy

    • Analyze substrate movement correlating with ABCG4 localization

In Vitro Transport Assays:

  • Membrane vesicle transport:

    • Isolate membrane vesicles from ABCG4-overexpressing cells

    • Initiate transport by adding ATP and substrate

    • Terminate at various timepoints by rapid filtration

    • Quantify transported substrate by scintillation counting or fluorescence

  • Reconstituted proteoliposome system:

    • Purify recombinant ABCG4

    • Reconstitute into liposomes with defined lipid composition

    • Initiate transport with ATP addition

    • Measure substrate accumulation inside vesicles

Data Analysis Framework:

  • Calculate initial transport rates at multiple substrate concentrations

  • Determine kinetic parameters (Km, Vmax)

  • Assess effects of potential inhibitors

  • Compare transport efficiency between wild-type and mutant ABCG4 variants

This multi-faceted approach allows for robust characterization of ABCG4 transport activity while accounting for technical limitations of individual assay systems.

What insights can Dictyostelium ABCG4 studies provide about the evolution of ABC transporters?

Dictyostelium ABCG4 occupies a unique evolutionary position that offers valuable insights into ABC transporter evolution:

Evolutionary Insights:

  • Ancient diversification patterns:

    • Dictyostelium diverged after plants but before the animal-fungal split

    • ABCG family in Dictyostelium contains both half and full transporters, suggesting both forms existed in the common ancestor

    • This contradicts earlier hypotheses that half-transporters evolved later from full transporters

  • Selective retention patterns:

    • Animals retained and expanded half-transporters

    • Fungi kept only full transporters with characteristic Walker A modifications

    • Plants and Dictyostelium maintained both types

    • This suggests functional specialization drove evolutionary retention

  • Domain arrangement conservation:

    • The unique ABC-first, TM-second arrangement of ABCG transporters is conserved in Dictyostelium

    • This arrangement likely arose before the divergence of major eukaryotic lineages

    • It may have originated from domain shuffling of ancestral ABC transporters

  • Functional adaptation evidence:

    • ABCG clusters in Dictyostelium show functional diversification

    • Some cluster with plant homologs, others with fungal homologs

    • This suggests parallel evolution of substrate specificity

Detailed phylogenetic analysis of Dictyostelium ABCG transporters reveals that the common progenitor of crown organisms likely carried at least two ABCG genes for full transporters, both retained and amplified in Dictyostelium but selectively kept in other lineages . This evolutionary perspective helps explain the diversity of contemporary ABCG transporters across eukaryotes.

How can recombinant antibodies against Dictyostelium ABCG4 be optimized for research applications?

Optimizing recombinant antibodies against Dictyostelium ABCG4 requires strategic approaches throughout development and application:

Antibody Development Strategy:

  • Antigen design considerations:

    • Select extracellular loops or soluble domains as antigens

    • Express multiple regions to generate diverse antibody repertoire

    • Ensure proper folding of recombinant antigen fragments

    • Validate antigen structure by circular dichroism or thermal shift assays

  • Selection technology optimization:

    • For hybridoma-derived antibodies: perform deep sequencing of variable regions

    • For phage display: use subtractive selection to enhance specificity

    • Implement stringent washing steps to obtain high-affinity binders

    • Perform multi-round selections with decreasing antigen concentration

  • Antibody format engineering:

    FormatAdvantagesBest Applications
    scFvSmall size, penetrates dense tissuesLive cell imaging
    FabEnhanced stability, reduced aggregationImmunoprecipitation
    Full IgGBivalent binding, Fc effector functionsWestern blotting
    NanobodyExtreme stability, recognizes hidden epitopesStructural studies

Application Optimization:

  • Immunofluorescence protocol refinement:

    • Optimize fixation method (paraformaldehyde vs. methanol)

    • Test different permeabilization approaches

    • Determine ideal antibody concentration through titration

    • Validate specificity using ABCG4-knockout cells as controls

  • Immunoprecipitation enhancement:

    • Couple antibodies to magnetic beads for gentle isolation

    • Optimize detergent for solubilization (maintain protein-protein interactions)

    • Include appropriate controls for nonspecific binding

    • Verify pulled-down complexes by mass spectrometry

  • Proximity labeling applications:

    • Fuse antibodies with enzymes like APEX2 or TurboID

    • Use for proximity labeling to identify ABCG4 interaction partners

    • Analyze labeled proteins by mass spectrometry

    • Map ABCG4 protein interaction network

The availability of sequenced recombinant antibodies against Dictyostelium antigens provides reliable reagents that can be consistently reproduced, addressing the challenge of limited commercial availability for this model organism .

What are the most promising future research directions for Dictyostelium ABCG4 studies?

Several promising research directions could significantly advance our understanding of Dictyostelium ABCG4:

Future Research Opportunities:

  • Structural biology approaches:

    • Cryo-EM structure determination of Dictyostelium ABCG4

    • Comparative structural analysis with mammalian and plant orthologs

    • Substrate binding site identification through computational docking

    • Structure-guided mutagenesis to validate functional predictions

  • Systems biology integration:

    • Multi-omics profiling of ABCG4 knockout Dictyostelium

    • Transcriptomics to identify compensatory mechanisms

    • Lipidomics to characterize changes in membrane composition

    • Proteomics to map interaction networks and post-translational modifications

  • Developmental biology applications:

    • Investigate ABCG4 expression during Dictyostelium life cycle transitions

    • Analyze role in multicellular development and cell differentiation

    • Explore potential involvement in signaling pathways during development

    • Examine cell type-specific functions during aggregation

  • Biotechnological applications:

    • Engineer ABCG4 for enhanced cholesterol transport capabilities

    • Develop Dictyostelium as a screening platform for ABCG modulators

    • Create biosensors based on ABCG4 transport activity

    • Explore potential for bioremediation applications

  • Evolutionary functional genomics:

    • Perform comparative functional studies across diverse species

    • Reconstruct ancestral ABCG sequences and test their function

    • Identify convergent and divergent functional adaptations

    • Map the evolutionary trajectory of substrate specificity

These research directions would not only enhance our understanding of Dictyostelium biology but could also provide insights applicable to human ABCG transporter function and potential therapeutic interventions for related disorders.

What are the most effective strategies for overcoming expression and purification challenges with recombinant Dictyostelium ABCG4?

Membrane protein expression and purification present significant challenges that require specialized approaches:

Challenge-Solution Framework:

  • Low expression levels:

    • Solution A: Screen multiple expression hosts (P. pastoris, insect cells, mammalian cells)

    • Solution B: Optimize codon usage for chosen expression system

    • Solution C: Test different promoters and induction conditions

    • Solution D: Create fusion constructs with well-expressed proteins (MBP, SUMO)

  • Protein misfolding:

    • Solution A: Lower expression temperature (16-20°C)

    • Solution B: Add chemical chaperones to growth media (glycerol, DMSO)

    • Solution C: Co-express with molecular chaperones

    • Solution D: Use GFP fusion to monitor folding and screen conditions

  • Inefficient solubilization:

    ChallengeOptimized ApproachExpected Outcome
    Incomplete extractionTest detergent panel (DDM, LMNG, GDN)Identify optimal extraction conditions
    Protein instabilityInclude cholesterol and specific lipidsStabilize native conformation
    Aggregation during purificationAdd glycerol to all buffersPrevent aggregation during concentration
    Loss of activityUse styrene maleic acid copolymerMaintain native lipid environment
  • Purification optimization:

    • Implement two-step purification strategy (affinity + size exclusion)

    • Include ATP or transition state analogs in buffers to stabilize conformation

    • Monitor protein quality by analytical size exclusion and dynamic light scattering

    • Verify function at each purification step through ATPase assays

These strategies specifically address the challenges of working with eukaryotic membrane transporters like ABCG4, enhancing the likelihood of obtaining functional protein for structural and biochemical studies.

How can contradictory results between in vitro and in vivo studies of ABCG4 function be reconciled?

Reconciling contradictory results between different experimental systems requires systematic analysis:

Methodological Reconciliation Framework:

  • System-specific variable identification:

    • Compare membrane compositions between in vitro and in vivo systems

    • Assess differences in post-translational modifications

    • Evaluate pH, ionic strength, and other environmental factors

    • Consider presence/absence of regulatory proteins

  • Experimental design harmonization:

    • Design experiments with overlapping readouts between systems

    • Use identical substrate concentrations across systems

    • Implement consistent temperature and buffer conditions

    • Develop internal controls that behave predictably in both systems

  • Bridging approaches:

    • Utilize semi-in vitro systems (permeabilized cells, isolated organelles)

    • Perform genetic complementation experiments

    • Create chimeric proteins combining domains from different sources

    • Use proximity labeling to identify system-specific interaction partners

  • Integrated data analysis:

    • Develop mathematical models incorporating both datasets

    • Identify parameters that explain discrepancies

    • Test model predictions with targeted experiments

    • Refine hypotheses based on integrated analysis

For example, the discrepancy between in vitro studies suggesting ABCG4 exports Aβ and inhibits γ-secretase versus in vivo knockout studies showing no exacerbation of AD phenotype could be reconciled by examining compensatory mechanisms, developmental timing of intervention, or differences in biological context between systems.

What are the broader implications of Dictyostelium ABCG4 research for understanding human disease mechanisms?

Dictyostelium ABCG4 research has several translational implications for human disease understanding:

Translational Implications:

  • Evolutionary conservation insights:

    • Fundamental mechanisms of ABC transporter function conserved from Dictyostelium to humans

    • Identification of essential vs. adaptable domains with therapeutic relevance

    • Understanding substrate recognition principles applicable across species

    • Evolutionary patterns revealing functional redundancy important for drug targeting

  • Neurodegenerative disease connections:

    • ABCG4 has been implicated in cholesterol metabolism and potentially Alzheimer's disease

    • Dictyostelium studies could reveal fundamental aspects of cellular cholesterol homeostasis

    • Unexpected knockout results in AD mouse models highlight need for deeper mechanistic understanding

    • Alternative hypotheses about ABCG4 function can be tested in simplified Dictyostelium system

  • Model system advantages:

    • Dictyostelium offers genetic tractability not always available in mammalian systems

    • Higher-throughput screening possibilities for ABCG4 modulators

    • Ability to study ABCG4 in context of development and cell differentiation

    • Less functional redundancy may reveal phenotypes masked in mammalian systems

  • Methodological advancements:

    • Recombinant antibody technologies developed for Dictyostelium applicable to human studies

    • Expression and purification strategies potentially transferable to human ABCG proteins

    • Novel assay systems could be adapted for human transporter studies

    • Structural insights from Dictyostelium ABCG4 may inform human ABCG4 structure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.