Recombinant Dictyostelium discoideum ABC transporter G family member 8 (abcG8)

Shipped with Ice Packs
In Stock

Description

Functional Role in D. discoideum

ABCG8 is implicated in sterol homeostasis and developmental signaling, though its exact role remains under investigation:

  • Developmental Regulation: D. discoideum ABCG transporters influence spore and stalk cell differentiation. While abcG6 and abcG18 directly modulate terminal differentiation via intercellular signaling , abcG8’s role appears subtler, potentially involving sterol transport or detoxification .

  • Chemotaxis and cAMP Signaling: ABC transporters like ABCC8 mediate cyclic adenosine monophosphate (cAMP) release during chemotaxis . Although abcG8 knockout mutants show no severe developmental defects, functional redundancy with other ABCG members is plausible .

  • Evolutionary Conservation: ABCG8 homologs in humans (e.g., ABCG5/G8 heterodimers) regulate cholesterol excretion, suggesting conserved roles in sterol transport across species .

Research Applications

Recombinant abcG8 is utilized in:

  • Mechanistic Studies: Investigating ATP-dependent transport kinetics and substrate specificity (e.g., sterols, xenobiotics) .

  • Drug Resistance: Modeling ABC transporter-mediated multidrug resistance in eukaryotes .

  • Developmental Biology: Analyzing D. discoideum morphogenesis and signal transduction pathways .

Production and Purification

The protein is expressed in E. coli and purified via affinity chromatography using its His tag. Critical protocols include:

  • Reconstitution: Optimal solubility requires glycerol supplementation to prevent aggregation .

  • Storage: Stable at -80°C; repeated freeze-thaw cycles degrade activity .

Related Recombinant Proteins

Comparative studies leverage orthologs and paralogs:

ProductSpeciesApplicationsSource
Recombinant Rat ABCG8Rattus norvegicusCholesterol transport assays
Recombinant Human ABCG8Homo sapiensDisease modeling (e.g., sitosterolemia)
Recombinant D. discoideum ABCG5D. discoideumSterol heterodimer studies

Challenges and Future Directions

  • Functional Redundancy: Subtle phenotypes in abcG8 knockouts suggest overlapping roles with other ABCG transporters .

  • Substrate Identification: ATPase activity and sterol-binding assays are needed to confirm biochemical roles .

  • Structural Insights: Cryo-EM or X-ray crystallography could resolve transport mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will then prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is dependent on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
abcG8; DDB_G0274117; ABC transporter G family member 8; ABC transporter ABCG.8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-626
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
Target Protein Sequence
MELETIEYNKSFNICENGDSKGVQLTFKNISYKVENKNYNKNKKEKNKNKIDPEFVNLDN KTENSNEKEITILYNVGGVIEKGELVALMGPSGSGKSTLLDILAQRKSTGKITGQLLVNG KEIGEAYKKYCSYVTQEDVLLQTYTVFETLKFYADLKLPGVSEIEKIKRVEKVIEDVGLT LKRDSRVGGVLAGGVAVTGLSGGEKRRVSIGCGLITNPSLIFLDEPTSGLDSVAALQIMK TLLNLTLKGVTVICSIHQPRPEIFQLINKVMVIIKGKMIYSGSNILEYFESLGYPCPNNT NPADFCLDSAVEIGEGERYTEICNQWENKWENQLTNEIEYPSLNVDIPKTTSWVYQYWIL LNREWRGFIRNKGNALSRVITAIVIGALFGSCFAGLKESDADVQKIMGTLFFLTTGLMLS PFSMITLFLSGRQLFNSERASKIYHSFPYFLSMITVELTIEFFVTLVEVTVCYMLARLRM DAGRFFFAVLVYSFIHSLSTFFISSLANLTGTSDLTFSYASSLSVVFMLFAGFYVPTNEL PRAFGWLHWVNPAFYGYSSVVINQFEDLQLKCTDEPCKFTNGNQVIEYYGIEDWTRGGSF GVLVAWATFFYSLSYFALHFLHREKR
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it used as a model organism?

Dictyostelium discoideum is a social amoeba that offers unique advantages for studying fundamental cellular processes, host-pathogen interactions, and molecular causes of human diseases. It is widely used as a model organism because it can be easily grown in large amounts and is amenable to diverse biochemical, cell biological, and genetic approaches . Throughout their life cycle, D. discoideum cells are motile, making them ideal for studying random and directed cell motility, signal transduction, and the actin cytoskeleton .

As a professional phagocyte, it can be infected with several human bacterial pathogens and used to study the infection process . The availability of numerous knock-out mutants makes it particularly useful for investigating host cell factors . Furthermore, D. discoideum has increasingly been used for studying neurological disorders including Alzheimer's disease, Parkinson's disease, Huntington's disease, neuronal ceroid lipofuscinoses, and lissencephaly .

What are ABC transporters and what is their significance in Dictyostelium discoideum?

ATP-binding cassette (ABC) transporters are membrane proteins that can translocate a broad spectrum of molecules across cell membranes, including physiological cargo and toxins . Their significance in D. discoideum includes:

  • The D. discoideum genome contains 68 annotated ABC transporters, making it one of the most diverse ABC transporter systems among eukaryotes .

  • These transporters play various roles in development, cell signaling, and resistance to toxins .

  • Most ABC transporter mutants in D. discoideum exhibit subtle morphological phenotypes, suggesting functional redundancy or specialized roles under specific conditions .

The ABCG family, to which abcG8 belongs, has a unique topology where the ATP-binding domain precedes the transmembrane domain, unlike other ABC transporter families . This family may have arisen from the fusion of independent ABC and transmembrane domains or from the central portion of members of the A, B, or C families .

What is the specific function of abcG8 in Dictyostelium discoideum?

The specific function of abcG8 in D. discoideum is not fully characterized in the provided sources, but research indicates:

  • abcG8 is one of the members of the ABCG family of ABC transporters in D. discoideum .

  • Like other ABC transporters, it likely functions in translocating specific molecules across cell membranes .

  • While mutations in abcG8 show subtle phenotypes, its function may become more apparent under specific developmental or stress conditions .

  • Evolutionary analyses suggest that abcG8 clusters with other D. discoideum ABCG half-transporters, indicating potential functional relationships within this group .

Unlike some other ABCG family members such as abcG6 and abcG18, which have been implicated in intercellular signaling during terminal differentiation of spores and stalks, the specific developmental or physiological contexts in which abcG8 functions remain to be fully elucidated .

What are the technical specifications of recombinant abcG8 protein?

The technical specifications of recombinant D. discoideum abcG8 protein include:

PropertySpecification
Full NameRecombinant Full Length Dictyostelium discoideum ABC transporter G family member 8(abcG8) Protein
UniProt IDQ86HQ2
LengthFull Length (1-626 amino acids)
TagN-terminal His tag
Expression SystemE. coli
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage RecommendationStore at -20°C/-80°C upon receipt; aliquoting is necessary for multiple use
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% glycerol

The amino acid sequence of the recombinant abcG8 protein is available in full detail, spanning 626 amino acids with a unique structure characteristic of ABCG family transporters .

How do mutations in abcG8 affect Dictyostelium discoideum development?

Studies of mutations in ABC transporter genes, including abcG8, have generally revealed subtle morphological phenotypes, suggesting potential functional redundancy among these transporters . Systematic studies have analyzed both morphological and transcriptional phenotypes during growth and development .

To study abcG8 function, researchers create gene disruption mutants by introducing linearized gene targeting vectors into growing wild-type cells by electroporation . The methodology involves:

  • Linearizing gene targeting vectors by restriction enzymes (like SacII)

  • Introducing these vectors into wild-type AX3 cells by electroporation

  • Selecting transformants using appropriate antibiotics (like blasticidin)

  • Harvesting cells after 5-7 days and plating on agar with bacteria to form individual colonies

  • Screening randomly selected clones for gene disruption by PCR and confirming by Southern blot analysis

Transcriptional phenotypes may provide more sensitive indicators of gene function than morphological phenotypes, especially for genes with subtle or condition-specific roles .

What experimental approaches are used to study abcG8 function in Dictyostelium discoideum?

Several experimental approaches are used to study abcG8 function in D. discoideum:

  • Genetic Approaches:

    • Gene disruption through homologous recombination

    • Creation of fusion constructs (e.g., with fluorescent proteins like RFP) to visualize protein localization

    • Complementation studies to confirm phenotypes are due to the targeted mutation

  • Phenotypic Analysis:

    • Morphological assessment during development

    • Transcriptional profiling to identify changes in gene expression patterns

    • Analysis of streaming and fruiting body formation

  • Biochemical Approaches:

    • Purification of recombinant proteins for functional studies

    • Mass spectrometry to identify interacting proteins

    • Transport assays to measure substrate specificity

  • Cell Biological Techniques:

    • Microscopy to visualize protein localization and cellular behaviors

    • Analysis of cell motility and chemotaxis

    • Investigation of vesicle secretion and function

  • Pharmacological Studies:

    • Use of inhibitors specific to ABC transporters to assess function

    • Analysis of resistance to various toxins or drugs

How does abcG8 compare evolutionarily to other ABC transporters in different species?

Evolutionary analyses of abcG8 in relation to other ABC transporters reveal:

  • The ABCG family, to which abcG8 belongs, has a unique topology where the ATP-binding domain precedes the transmembrane domain, unlike other ABC transporter families .

  • Most D. discoideum ABCG half-transporters, including abcG8, cluster together, suggesting potential co-evolution and functional relationships .

  • Some D. discoideum ABCG proteins cluster with Drosophila, Arabidopsis, and human homologs, indicating conservation across diverse species .

  • The ABCG family may have arisen from the fusion of independent ABC and TM domains or from the central portion of members of the A, B, or C families .

  • The ABC domains of the G family cluster together on the branch that also carries the ABC domains of the A family, suggesting an ABCA gene as the most likely source of the original ABCG gene .

The evolutionary history of ABC transporters suggests that the progenitor of crown organisms carried multiple ABC transporter genes that expanded differently in various lineages . This explains why some ABC transporters are found in D. discoideum but not in animals, while others are conserved across multiple kingdoms .

What is the role of abcG8 in cell migration and chemotaxis?

While the specific role of abcG8 in cell migration and chemotaxis is not extensively detailed in the provided search results, research on ABC transporters in D. discoideum provides context:

  • ABC transporters in D. discoideum play important roles in chemotaxis and streaming behavior during development .

  • Some ABC transporters, such as ABCC8, regulate cAMP transport in extracellular vesicles (EVs), which is crucial for chemotaxis and cell-cell communication .

  • EVs containing ABC transporters can synthesize and release chemoattractants, amplifying attractant gradients and facilitating directed cell migration .

  • Mutations in ABC transporters can lead to defects in streaming and fruiting body formation, indicating their importance in coordinated cell movement .

How can studies of abcG8 in Dictyostelium discoideum contribute to understanding human diseases?

Studies of abcG8 in D. discoideum can contribute to understanding human diseases in several ways:

  • D. discoideum is increasingly used as a model organism for investigating human disease genes and host-pathogen interactions .

  • ABC transporters in humans are associated with various diseases, including cystic fibrosis and multidrug resistance in cancer .

  • Understanding the function and regulation of ABC transporters in D. discoideum can provide insights into conserved mechanisms that may be relevant to human ABC transporter function .

  • D. discoideum has been specifically used as a model for studying neurological disorders, including Alzheimer's disease, Parkinson's disease, and Huntington's disease .

  • The simple cellular system of D. discoideum allows for more direct analysis of gene function without the complexity of multicellular tissues .

The availability of numerous D. discoideum knockout mutants, including those for ABC transporters like abcG8, provides valuable tools for investigating gene function in a controlled genetic background . This can help elucidate the roles of homologous human genes in disease contexts.

What are the challenges in expressing and purifying recombinant abcG8 for structural studies?

Expressing and purifying recombinant abcG8 for structural studies presents several challenges:

  • Membrane Protein Expression:

    • As a membrane protein, abcG8 can be difficult to express in sufficient quantities for structural studies .

    • Proper folding and insertion into membranes is crucial for maintaining native structure and function .

    • Expression systems must be carefully chosen; E. coli is commonly used but may not provide all post-translational modifications present in D. discoideum .

  • Solubilization and Stability:

    • Extracting membrane proteins from lipid bilayers requires detergents that must maintain protein stability and activity.

    • The protein may be unstable once removed from its native membrane environment .

  • Purification Efficiency:

    • Achieving high purity (>90%) is essential for structural studies .

    • The N-terminal His tag used in the recombinant abcG8 facilitates purification but may affect protein structure or function .

  • Storage and Handling:

    • Recombinant abcG8 is typically provided as a lyophilized powder and requires careful reconstitution .

    • Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

    • Long-term storage requires the addition of stabilizing agents such as glycerol .

To address these challenges, researchers should carefully follow recommended protocols for reconstitution and storage, including reconstituting the protein in deionized sterile water and adding glycerol for long-term storage at -20°C/-80°C .

How can researchers optimize experiments using recombinant abcG8?

To optimize experiments using recombinant abcG8, researchers should consider:

  • Protein Handling and Storage:

    • Briefly centrifuge the vial before opening to bring contents to the bottom .

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C .

    • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week .

  • Experimental Design:

    • Include appropriate positive and negative controls in all experiments.

    • Validate antibody specificity if using immunological detection methods.

    • Consider the native cellular environment of abcG8 when designing functional assays.

    • Use complementary approaches (biochemical, genetic, cell biological) to validate findings .

  • Functional Assays:

    • Develop assays to assess transporter activity based on potential substrates.

    • Consider using fluorescently labeled substrates for real-time monitoring of transport.

    • Test activity under different conditions to determine optimal parameters.

  • Cell-Based Assays:

    • Express recombinant abcG8 in abcG8-deficient D. discoideum cells to assess functional complementation .

    • Use fluorescently tagged versions to track localization and dynamics in living cells .

    • Combine with other mutations to identify genetic interactions .

By following these optimization strategies, researchers can maximize the utility of recombinant abcG8 in their experimental systems and obtain more reliable and reproducible results.

What are common issues encountered when working with recombinant abcG8 and how can they be resolved?

Common issues when working with recombinant abcG8 and their solutions include:

  • Low Protein Solubility:

    • Issue: Recombinant abcG8 may aggregate or precipitate during reconstitution.

    • Solution: Optimize buffer conditions, try different detergents, reconstitute at lower protein concentrations, or adjust the temperature during reconstitution .

  • Protein Degradation:

    • Issue: The protein may degrade during storage or experiments.

    • Solution: Add protease inhibitors to buffers, avoid repeated freeze-thaw cycles, store at appropriate temperatures (-20°C/-80°C for long-term storage, 4°C for short-term) .

  • Loss of Activity:

    • Issue: The recombinant protein may lose functional activity during purification or storage.

    • Solution: Verify activity immediately after reconstitution, optimize storage conditions by adding stabilizing agents like glycerol (5-50%) .

  • Inconsistent Results:

    • Issue: Experiments may yield variable or inconsistent results.

    • Solution: Standardize protein handling protocols, use the same batch of protein for comparative experiments, include appropriate controls .

  • Poor Detection:

    • Issue: Difficulty detecting the protein in experimental systems.

    • Solution: Verify antibody specificity and sensitivity, optimize detection methods, use the His tag for detection if native antibodies are unavailable .

To maximize experimental success, always follow the recommended storage and handling guidelines: reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add 5-50% glycerol for long-term storage, and aliquot to minimize freeze-thaw cycles .

How should researchers interpret contradictory data regarding abcG8 function?

When faced with contradictory data regarding abcG8 function, researchers should:

  • Examine Experimental Conditions:

    • Different experimental conditions can significantly affect protein function.

    • Verify that all experiments used comparable conditions or account for differences in analysis.

  • Consider Genetic Background Effects:

    • The phenotypic effects of abcG8 mutations may vary depending on the genetic background of D. discoideum strains .

    • Document the specific strain used and consider testing in multiple genetic backgrounds.

  • Assess Functional Redundancy:

    • The subtle phenotypes observed in abc-transporter mutants suggest functional redundancy .

    • Test for potential compensation by other ABC transporters, particularly other members of the ABCG family .

  • Consider Context-Specific Functions:

    • ABC transporters may have different roles depending on developmental stage or environmental conditions .

    • Test function under various conditions (starvation, stress, different developmental stages) .

  • Perform Quantitative Analysis:

    • Use statistical methods to determine the significance of observed differences.

    • Report effect sizes along with statistical significance to better interpret biological relevance.

By systematically addressing these factors, researchers can better interpret contradictory data and develop more robust hypotheses about abcG8 function.

What quality control measures should be implemented when working with recombinant abcG8?

To ensure the reliability of experiments using recombinant abcG8, researchers should implement the following quality control measures:

  • Protein Purity Assessment:

    • Verify protein purity by SDS-PAGE (should be >90% as indicated in specifications) .

    • Consider using size-exclusion chromatography to assess aggregation state.

    • Confirm protein identity by mass spectrometry or Western blotting.

  • Functional Validation:

    • Develop assays to verify that the recombinant protein retains its expected activity.

    • Compare activity to native protein when possible.

    • Test known substrates or inhibitors to confirm functionality.

  • Stability Monitoring:

    • Assess protein stability over time under experimental conditions.

    • Monitor for degradation using SDS-PAGE or Western blotting.

    • Establish criteria for determining when protein quality is insufficient for experiments.

  • Storage Verification:

    • Document storage conditions and duration for each batch .

    • Test activity after various storage times to establish a reliable shelf-life.

    • Implement a tracking system for different batches and aliquots.

  • Proper Controls:

    • Include negative controls (buffer only, inactive mutant protein).

    • Use positive controls (proteins with known activity).

    • Include internal standards in quantitative assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.