Recombinant Dictyostelium discoideum Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (slc35b2)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Gene and Protein Information

  • Gene name: slc35b2 (also annotated as DDB_G0269602 or papst1 in Dictyostelium discoideum) .

  • Function: Transports PAPS to the Golgi, enabling sulfotransferase-mediated sulfation of substrates such as heparan sulfate and tyrosine residues on proteins .

Production and Purification

  • Host systems: Expressed in E. coli, yeast, baculovirus, or mammalian cells, with cell-free expression systems also utilized .

  • Purity: ≥85% purity (SDS-PAGE confirmed) .

  • Applications:

    • Positive control in biochemical assays .

    • Immunogen for antibody generation .

    • Functional studies of sulfation-dependent processes .

Role in Sulfation and Disease Research

Mechanistic Insights

  • Viral entry: Human SLC35B2 homologs regulate sulfation of heparan sulfate and SCARB2, a receptor for enterovirus EV71. Knockout studies show reduced viral binding/internalization, linking sulfation to viral pathogenesis .

  • Neurological models: Dictyostelium is used to study conserved cellular processes, including γ-secretase activity and autophagy, with recombinant slc35b2 aiding in understanding sulfation’s role in these pathways .

Comparative Analysis Across Species

SpeciesGene NameHost SystemsKey Functions
Dictyostelium discoideumslc35b2Cell-free, E. coliPAPS transport; model for sulfation in simple eukaryotes .
Homo sapiensSLC35B2Mammalian cells, yeastDual role in heparan sulfate and protein tyrosine sulfation .
Mus musculusSlc35b2E. coli, baculovirusSulfation-dependent immune and developmental pathways .

Research Applications and Findings

Key Studies

  1. CRISPR-Cas9 Screening:

    • SLC35B2 knockout in human cells reduced EV71 infection by disrupting heparan sulfate sulfation and SCARB2 tyrosine sulfation .

  2. Sulfation Dependency:

    • Sodium chlorate (sulfation inhibitor) and PAPS synthetase knockouts diminished EV71 infectivity, underscoring SLC35B2’s role .

  3. Model Organism Utility:

    • Dictyostelium’s slc35b2 provides insights into evolutionarily conserved transport mechanisms, applicable to human disease models .

Future Directions

  • Therapeutic targeting: SLC35B2 inhibitors could block viral entry or pathological sulfation in diseases like cancer or neurodegeneration .

  • Structural studies: High-resolution imaging of slc35b2 could clarify its transport mechanism and interaction with PAPS .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that specific tag.
Synonyms
slc35b2; papst1; DDB_G0269602; Adenosine 3'-phospho 5'-phosphosulfate transporter 1; PAPS transporter 1; Solute carrier family 35 member B2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
slc35b2
Target Protein Sequence
MGSGIEVNDSSTTNSNNNEKVQLSYNMKLALATGGIMGSFLLYGILQERLMVVPYKNADG SEEYFTDSTFLVLSNRVFAALMAIVIVLKRGESLKNVAPLHKYVGVALSNFCATWCQYEA LKYVNFPTQTLGKCGKMLPVMLVGTFISGKKYGLKDYSIALTITTGCMIFFLTGKISNNE SSNTSYGIILMALYMFFDSFTSTFQEKMFKGYTMSTYDQMIYVNGCSSIISVFILILNGR LFPAIEFISTHNGVFFDSTMLSASAGLGQMVIYYTIKEFGALVFSTIMVTRQMVSIILST LIYLHPLSNTQWIGALLVFGTLYYKSIEDSKKKHGGHSHGGSNAATTTTPSNNSNNTEK
Uniprot No.

Target Background

Function
This protein mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS) from the cytosol into the Golgi apparatus. PAPS serves as a universal sulfuryl donor for sulfation events occurring within the Golgi.
Database Links
Protein Families
Nucleotide-sugar transporter family, SLC35B subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Adenosine 3'-phospho 5'-phosphosulfate transporter 1 in Dictyostelium discoideum?

Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (slc35b2) in Dictyostelium discoideum functions as a specialized transporter that facilitates the movement of 3'-phosphoadenosine 5'-phosphosulfate (PAPS) across Golgi membranes. PAPS serves as a universal sulfuryl donor critical for sulfation reactions within the cell. The transporter is essential for proper post-translational modification of proteins through sulfation, a process necessary for normal cellular function. In other organisms, PAPS transporters localize to the Golgi membrane and are classified as type III transmembrane proteins . Research indicates that PAPS transporters are essential for viability, as demonstrated through RNA interference studies in Drosophila with the orthologous gene slalom (sll) .

How conserved is the slc35b2 gene across different species, and what implications does this have for researchers?

The slc35b2 gene shows significant conservation across evolutionary diverse species, supporting its fundamental role in cellular processes. Human PAPST1 (432 amino acids) exhibits 48.1% sequence identity with Drosophila SLL (465 amino acids) . Both proteins are predicted to be type III transmembrane proteins with similar topology and function. This conservation suggests that Dictyostelium slc35b2 likely shares structural and functional elements with its orthologs. The high degree of conservation makes Dictyostelium discoideum an excellent model organism for studying the fundamental aspects of PAPS transport that may be applicable to higher organisms, including humans. Researchers can leverage this conservation to investigate evolutionarily preserved mechanisms of sulfation and associated pathways.

What experimental approaches are recommended for confirming subcellular localization of slc35b2 in Dictyostelium discoideum?

To confirm the subcellular localization of slc35b2 in Dictyostelium discoideum, researchers should employ multiple complementary techniques:

  • GFP fusion proteins: Create N- or C-terminal GFP fusion constructs for live-cell imaging. Similar approaches with PAPS transporters in other systems have shown localization to the Golgi membrane .

  • Immunofluorescence microscopy: Use antibodies against the native protein or epitope tags (if generating recombinant versions) combined with markers for different cellular compartments.

  • Subcellular fractionation: Isolate cellular compartments through differential centrifugation and detect the protein via Western blotting, similar to studies of PsenB, Ncst, and Aph1 in Dictyostelium .

  • Colocalization studies: Use established Golgi markers concurrently with your tagged slc35b2 construct, as performed in transient expression studies of human PAPST1 in SW480 cells .

When designing these experiments, careful consideration should be given to potential artifacts from overexpression or tag interference with protein folding or trafficking.

What are the optimal strategies for enhancing homologous recombination efficiency when creating slc35b2 mutants in Dictyostelium?

Creating slc35b2 mutants in Dictyostelium can be challenging due to variable homologous recombination (HR) rates. Based on research with other Dictyostelium genes, several strategies can significantly improve HR efficiency:

  • Cre/loxP system: A highly effective approach involves engineering a Dictyostelium line containing a single loxP site adjacent to slc35b2 and introducing replacement DNA with another loxP site in a homologous position. In the presence of CRE recombinase, homologous recombination rates have been increased from ~25% to ~80% at other loci such as sec1A . This significant enhancement is likely driven by intermolecular recombination between the two loxP sites.

  • Homology arm length optimization: Using longer homology arms (>1 kb on each side) can improve HR rates.

  • Linear vs. circular DNA: Linear DNA with exposed homology arms often yields better HR rates than circular plasmids.

  • Targeting vector design: Include positive and negative selection markers to enrich for true homologous recombinants.

Table 1 provides a comparison of homologous recombination efficiencies using different approaches:

MethodTypical HR RateExample GeneReference
Standard HR0-30%Various
Single loxP site-enhanced HR~80%sec1A
High-efficiency loci (natural)~95%nsfA

The Cre/loxP system presents a particularly valuable approach for genes with naturally low HR rates, potentially allowing for the generation of conditional or temperature-sensitive mutants in essential genes like slc35b2.

How should researchers design functional assays to quantify slc35b2 transport activity in vitro and in vivo?

Designing robust functional assays for slc35b2 transport activity requires multiple approaches:

In vitro assays:

  • Reconstituted proteoliposome transport assays: Purify recombinant slc35b2 and incorporate it into artificial liposomes. Measure uptake of radiolabeled PAPS (3'-phosphoadenosine 5'-phosphosulfate) across the membrane over time.

  • Microsomal vesicle transport: Isolate Golgi-enriched vesicles from Dictyostelium cells expressing recombinant slc35b2 and measure PAPS uptake, similar to methods used for yeast expressing PAPST1 and SLL .

  • Competition assays: Evaluate specificity by testing whether unlabeled PAPS or other nucleotide derivatives compete with radiolabeled PAPS transport.

In vivo assays:

  • Sulfation reporter systems: Develop reporter proteins that undergo sulfation when PAPS transport is functional and can be readily detected.

  • Complementation studies: Test whether Dictyostelium slc35b2 can rescue phenotypes in yeast or mammalian cells with deficient PAPS transport, similar to expression studies showing increased PAPS transport in Golgi membranes when human PAPST1 and Drosophila SLL were expressed in yeast .

  • Phenotypic analysis: Create conditional slc35b2 mutants and analyze development, cell motility, and other processes potentially affected by defective sulfation.

For quantification accuracy, calibration curves using known PAPS concentrations should be established, and transport kinetics should be analyzed to determine Km and Vmax values.

What strategies are recommended for expressing and purifying functional recombinant Dictyostelium slc35b2 while maintaining protein activity?

Expressing and purifying functional membrane proteins like slc35b2 presents significant challenges. Based on related research, the following comprehensive strategy is recommended:

Expression systems:

  • Dictyostelium expression: Use inducible promoters such as the discoidin promoter or tetracycline-regulated systems for homologous expression.

  • Heterologous expression: Consider specialized systems for membrane proteins such as:

    • Pichia pastoris (handles complex membrane proteins well)

    • Insect cell/baculovirus systems (appropriate for eukaryotic post-translational modifications)

    • Cell-free expression systems (allows direct incorporation into nanodiscs or liposomes)

Purification approach:

  • Affinity tags: Incorporate polyhistidine or strep tags, preferably with a cleavable linker.

  • Detergent selection: Screen multiple detergents (DDM, LMNG, CHAPS) for optimal extraction while maintaining function.

  • Stabilization strategies:

    • Include cholesterol or specific lipids during purification

    • Use nanodiscs or amphipols for detergent-free environments

    • Consider thermostabilizing mutations if structure-function studies exist for orthologs

Activity preservation:

  • Transport activity measurements: Perform functional assays at each purification step to monitor activity retention.

  • Reconstitution: Incorporate purified protein into liposomes composed of Golgi-mimicking lipids to test transporter functionality post-purification.

When designing these expression systems, researchers should consider that transmembrane proteins like slc35b2 often require specialized handling to maintain their native conformation and activity throughout the purification process.

How does the predicted structure of Dictyostelium slc35b2 compare to mammalian PAPS transporters, and what are the implications for substrate specificity?

While the complete structure of Dictyostelium slc35b2 has not been fully determined, comparative analysis with known PAPS transporters provides valuable insights:

Based on orthologous transporters, Dictyostelium slc35b2 likely shares the type III transmembrane protein architecture seen in human PAPST1 (432 amino acids) and Drosophila SLL (465 amino acids) . Structural predictions suggest multiple transmembrane domains with specific substrate binding pockets that accommodate the unique chemical properties of 3'-phosphoadenosine 5'-phosphosulfate.

Key structural features likely include:

  • Conserved transmembrane helices forming a translocation pathway

  • Cytoplasmic and luminal loops containing charged residues for substrate recognition

  • Potential conformational changes during transport cycle (alternating access model)

Comparing amino acid sequences and predicted structures between Dictyostelium slc35b2 and human PAPST1 would reveal conserved motifs potentially critical for PAPS recognition and transport. Variations in the substrate binding pocket might explain differences in substrate specificity or transport kinetics between species.

For researchers, these structural similarities make Dictyostelium an excellent model for studying the fundamental mechanisms of PAPS transport that are likely conserved in humans, while also allowing investigation of any unique adaptations in the Dictyostelium transporter.

What are the critical residues in slc35b2 that determine substrate specificity and transport function?

Identifying critical residues in slc35b2 requires comprehensive mutagenesis studies. Based on research with related transporters, several approaches are recommended:

  • Alanine scanning mutagenesis: Systematically replace conserved residues with alanine to identify those essential for transport activity or substrate recognition.

  • Charge reversal mutations: Target charged residues in predicted substrate binding regions, as PAPS contains negatively charged phosphate and sulfate groups that likely interact with positively charged amino acids within the transporter.

  • Chimeric protein analysis: Create chimeric proteins between Dictyostelium slc35b2 and orthologous transporters to identify domains responsible for specific functional properties.

  • Cross-species complementation: Test whether mutated versions of slc35b2 can rescue phenotypes in other organisms with defective PAPS transporters, similar to experiments where human presenilin proteins rescued developmental phenotypes in Dictyostelium presenilin-null mutants .

When conducting these studies, researchers should focus on:

  • Conserved residues between Dictyostelium slc35b2 and orthologous transporters like human PAPST1

  • Charged residues in predicted transmembrane domains

  • Residues in cytoplasmic and luminal loops that might participate in substrate recognition

The functional impact of mutations should be assessed using transport assays measuring PAPS uptake into vesicles or proteoliposomes containing the mutant transporters.

How can Dictyostelium slc35b2 research contribute to understanding human sulfation disorders?

Dictyostelium research on slc35b2 offers significant insights into human sulfation disorders through several mechanisms:

  • Functional conservation: The PAPS transporter pathway shows remarkable conservation across species. Mutations affecting genes related to PAPS synthesis are known to cause human inherited disorders , suggesting that disruptions in PAPS transport might similarly contribute to disease states.

  • Model system advantages: Dictyostelium provides a simplified system to study basic functions of the PAPS transport machinery without the complexity of mammalian models. Its haploid nature facilitates genetic manipulation and phenotypic analysis of mutations.

  • Pathway dissection: Studies in Dictyostelium can help delineate the specific cellular consequences of defective sulfation separate from secondary effects seen in more complex organisms.

  • Drug screening platform: The relatively simple cellular context of Dictyostelium makes it an excellent model for high-throughput screening of compounds that might restore function to defective PAPS transporters.

Researchers interested in human sulfation disorders should consider that Dictyostelium, like other model systems such as Drosophila, has demonstrated its value for investigating conserved cellular processes related to human diseases, particularly neurodegenerative disorders . By understanding the fundamental mechanisms of PAPS transport in Dictyostelium, researchers may uncover therapeutic targets relevant to human sulfation disorders.

What experimental approaches can link slc35b2 function to specific cellular pathways potentially affected in disease states?

To establish connections between slc35b2 function and disease-relevant cellular pathways, researchers should employ multi-faceted experimental strategies:

  • Omics approaches:

    • Proteomics: Compare sulfated protein profiles between wild-type and slc35b2-mutant Dictyostelium to identify specifically affected targets.

    • Metabolomics: Analyze changes in sulfation-dependent metabolites.

    • Transcriptomics: Identify compensatory pathways activated when PAPS transport is compromised.

  • Cellular phenotyping:

    • Development assays: Assess whether slc35b2 disruption affects multicellular development in Dictyostelium, similar to developmental defects observed in presenilin mutants .

    • Chemotaxis studies: Evaluate effects on directed cell movement, a process that may require properly sulfated signaling molecules.

    • Phagocytosis/macropinocytosis: Examine whether membrane trafficking is affected, as seen with γ-secretase components in Dictyostelium .

  • Mitochondrial function analysis:

    • Measure respiratory parameters using approaches similar to those employed in Dictyostelium studies of Parkinson's disease-related proteins .

    • Assess mitochondrial morphology and distribution when slc35b2 function is compromised.

  • Rescue experiments:

    • Test whether human PAPS transporter can rescue Dictyostelium slc35b2 mutant phenotypes, similar to how human presenilin rescued developmental defects in presenilin-null Dictyostelium .

The table below summarizes potential phenotypic readouts based on studies of other proteins in Dictyostelium:

Cellular ProcessExperimental ReadoutPotential Disease Relevance
DevelopmentFruiting body morphologyDevelopmental disorders
ChemotaxisDirected movement to cAMPImmune cell dysfunction
Mitochondrial functionOxygen consumption ratesMetabolic disorders
Membrane traffickingEndocytosis efficiencyLysosomal storage diseases
Protein sulfationPost-translational modification patternsMultiple sulfation-dependent disorders

By integrating these approaches, researchers can build a comprehensive understanding of how slc35b2 dysfunction affects cellular homeostasis and potentially contributes to disease mechanisms.

How can CRISPR-Cas9 technology be optimized for creating precise mutations in the slc35b2 gene in Dictyostelium?

Optimizing CRISPR-Cas9 for precise slc35b2 editing in Dictyostelium requires specific considerations:

  • Guide RNA design:

    • Select target sites with minimal off-target potential using Dictyostelium-specific algorithms

    • Target highly conserved functional domains identified through alignment with human PAPST1 and Drosophila SLL

    • Design multiple gRNAs to increase success probability

  • Delivery methods:

    • Electroporation of ribonucleoprotein complexes (Cas9 protein + gRNA) reduces off-target effects compared to plasmid-based expression

    • Consider transient expression systems with selectable markers for Cas9 and gRNA

  • Homology-directed repair (HDR) enhancement:

    • Provide repair templates with ~1kb homology arms on each side

    • Incorporate the loxP enhancement strategy that increased homologous recombination at the sec1A locus from ~25% to ~80%

    • Include silent mutations in the PAM site and seed region of the repair template to prevent re-cutting

  • Screening strategies:

    • Develop PCR-based screening approaches to identify edited clones

    • Consider phenotypic screens based on predicted effects of slc35b2 mutations

    • Use restriction fragment length polymorphism (RFLP) analysis by introducing or removing restriction sites in the edited region

  • Validation approaches:

    • Sequence the entire slc35b2 locus to confirm edits and check for unwanted mutations

    • Assess potential off-target sites bioinformatically predicted to be similar to the target sequence

    • Verify protein expression and localization changes using antibodies or fluorescent tags

For essential genes like slc35b2 (based on the essentiality of its orthologs), researchers should consider creating conditional mutants using inducible promoters or temperature-sensitive alleles to study gene function while maintaining viability.

What considerations are important when designing temperature-sensitive mutants of slc35b2 in Dictyostelium discoideum?

Creating temperature-sensitive (ts) mutants of slc35b2 requires careful design considerations based on successful approaches with other Dictyostelium genes:

  • Mutation strategy selection:

    • Random mutagenesis: Create a library of randomly mutagenized slc35b2 genes using error-prone PCR, followed by screening for temperature sensitivity.

    • Targeted approach: Introduce specific mutations at conserved residues that are likely to affect protein stability but not completely abolish function.

    • Homolog-guided design: Identify residues that confer temperature sensitivity in orthologous transporters from other organisms.

  • Technical implementation:

    • Use homologous recombination enhanced by the single loxP site strategy that increased efficiency from ~25% to ~80% at the sec1A locus .

    • Consider the gene replacement approach used for nsfA, where a library of mutagenized genes containing a selectable marker was used for transformation .

  • Screening considerations:

    • Design a high-throughput phenotypic screen specific to slc35b2 function.

    • Establish appropriate temperature conditions: typically, permissive temperature at 22°C and restrictive at 27-30°C for Dictyostelium.

    • Include positive controls such as known ts mutants (e.g., sec1Ats1) to validate screening conditions .

  • Validation requirements:

    • Confirm temperature-dependent protein expression and localization.

    • Verify that the phenotype is specifically due to slc35b2 dysfunction using rescue experiments.

    • Characterize the kinetics of protein inactivation after temperature shift.

  • Functional analysis:

    • Assess temperature-dependent effects on specific cellular processes including development, movement, and endocytosis.

    • Measure changes in sulfation patterns of specific proteins at permissive and restrictive temperatures.

The successful isolation of temperature-sensitive mutants in sec1A (with 30 ts mutants generated) demonstrates the feasibility of this approach in Dictyostelium and could serve as a valuable model for creating conditional slc35b2 mutants.

How can live-cell imaging techniques be optimized to study the dynamics of slc35b2 in Dictyostelium?

Optimizing live-cell imaging for slc35b2 dynamics requires specialized approaches for this Golgi-localized transporter:

  • Fluorescent protein selection:

    • Use monomeric, bright fluorescent proteins (mNeonGreen, mEmerald) that minimize oligomerization.

    • Consider photoconvertible proteins (Dendra2, mEos) for pulse-chase experiments tracking slc35b2 movement through cellular compartments.

    • Test both N- and C-terminal tags to determine which maintains proper localization and function.

  • Advanced microscopy techniques:

    • FRAP (Fluorescence Recovery After Photobleaching): Measure mobility and turnover rates of slc35b2 within the Golgi membrane.

    • FRET (Förster Resonance Energy Transfer): Detect interactions between slc35b2 and potential binding partners.

    • Super-resolution microscopy (STED, PALM/STORM): Resolve sub-Golgi distribution patterns beyond diffraction limits.

  • Multi-color imaging strategies:

    • Co-express markers for different Golgi sub-compartments (cis, medial, trans) to precisely localize slc35b2.

    • Use compartment-specific pH or PAPS sensors to correlate transporter activity with local environmental changes.

  • Technical considerations for Dictyostelium:

    • Optimize cell immobilization techniques using agarose overlays or specialized chambers that allow normal cell function.

    • Consider using total internal reflection fluorescence (TIRF) microscopy for visualizing events near the plasma membrane during trafficking.

    • Establish stable expression lines with fluorescently tagged Golgi markers for consistent co-localization studies.

  • Quantitative analysis approaches:

    • Implement automated tracking of vesicular structures containing slc35b2 during trafficking events.

    • Develop algorithms for measuring co-localization coefficients with established Golgi markers over time.

    • Quantify fluorescence intensity changes in response to sulfation pathway perturbations.

Similar approaches with γ-secretase complex components in Dictyostelium successfully demonstrated their localization to the endoplasmic reticulum , suggesting these techniques can be effectively applied to study slc35b2 dynamics.

What proteomic approaches can identify the interactome of slc35b2 in Dictyostelium and its substrate proteins?

Comprehensive proteomic analysis of slc35b2 interactions requires multiple complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged slc35b2 (FLAG, HA, or BioID) in Dictyostelium.

    • Use mild detergents (digitonin, DDM) to preserve membrane protein interactions.

    • Implement SILAC (Stable Isotope Labeling with Amino acids in Cell culture) for quantitative comparison between specific and non-specific interactions.

    • Employ appropriate controls including untransfected cells and cells expressing an unrelated membrane protein.

  • Proximity labeling techniques:

    • Fuse slc35b2 with BioID2 or TurboID for proximity-dependent biotinylation of neighboring proteins.

    • Optimize labeling conditions (biotin concentration, labeling time) for Dictyostelium.

    • Identify biotinylated proteins using streptavidin pulldown followed by mass spectrometry.

  • Crosslinking mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers with varying spacer lengths to capture transient interactions.

    • Apply specialized algorithms to identify crosslinked peptides revealing spatial proximity information.

  • Sulfated proteome analysis:

    • Compare sulfated protein profiles between wild-type and slc35b2-depleted cells using:

      • Anti-sulfotyrosine antibodies for immunoprecipitation

      • Metabolic labeling with 35S-sulfate

      • Enrichment methods specific for sulfated peptides

  • Data analysis and validation:

    • Implement bioinformatic filtering to identify high-confidence interactors and substrates.

    • Validate key interactions using orthogonal methods (co-immunoprecipitation, FRET).

    • Map interaction networks to identify functional clusters of proteins associated with slc35b2.

This multi-faceted approach would generate a comprehensive interactome of slc35b2, revealing both regulatory proteins and potential substrate proteins dependent on PAPS transport for proper sulfation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.