Recombinant Dictyostelium discoideum Aquaporin-B (aqpB)

Shipped with Ice Packs
In Stock

Description

Functional Properties of aqpB

aqpB exhibits distinct functional behaviors under different experimental conditions:

Wild-Type vs. Mutant Permeability

PropertyWild-Type aqpBMutant aqpB (Δ12 Loop D)
Water PermeabilityImpermeable to water, glycerol, and ureaActivated water channel
Gating MechanismClosed state (no permeability)Gated via loop D truncation
InhibitionN/AInhibited by mercuric chloride

Subcellular Localization

aqpB-GFP fusion constructs localize to:

  1. Vacuolar structures: Suggesting roles in osmotic regulation via contractile vacuoles .

  2. Plasma membrane: Potential involvement in water flux during cell-volume homeostasis .

  3. Lamellipodia-like protrusions: Implicating a role in amoeboid motility .

Recombinant Production and Applications

Recombinant aqpB is commercially available as a His-tagged protein (Cat. No. RFL28668DF) for research use. Key production details include:

ParameterSpecification
Expression HostE. coli
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)
Long-Term Storage-20°C/-80°C (with 50% glycerol)

Research Applications

  1. Osmoregulation Studies: Investigating gating mechanisms in vacuolar membranes .

  2. Motility Analysis: Assessing the role of water permeability in lamellipodia formation .

  3. Structural Biology: Probing the cysteine-dependent inhibition mechanism .

Significance in D. discoideum Biology

aqpB bridges gaps in understanding aquaporin function in protozoa:

  • Novel Gating: Unlike constitutively open AQPs in other species (e.g., T. cruzi), aqpB requires loop D truncation for activation .

  • Dual Localization: Vacuolar and lamellipodial localization suggests coordinated roles in osmotic balance and migration .

  • Developmental Expression: Detectable across D. discoideum’s life cycle, from amoebae to spores .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aqpB; DDB_G0279443; Aquaporin-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
aqpB
Target Protein Sequence
MSLKRSDDYQDLEEGIAMEDGGNIKDEEEKPLDPIEEQNKKRWVLIRAVLGELLCTFLFVYVLCATSANFIRLGSPPNPVVGGLSTGFAAVALIYSFADVSGAHFNPAVTFATCVTRKTSITKGLMYVGAQLVGSVLASLILLATFPGNFPGDKNAASAVAIAPSTDANIGNAFLTELVLTFILVYVIFAVAFDTVDNSVKTKVVGKSSSNNLTIYTTSGQTKAGFAPIAIGFTLGFLCFLGGSVSGGAFNPARVFGTALVGNNWTRHWMYWIADFLGAGLAGFAQKFFSSTHK
Uniprot No.

Target Background

Function
Putatively gated water-specific channel requiring a cysteine residue within the channel. It is impermeable to water, glycerol, and urea when expressed in *Xenopus* oocytes and is not regulated by pH; channel permeability to water remains unchanged at pH 7.4 and 5.2.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle.

Q&A

What is the structural characterization of Dictyostelium discoideum AqpB?

AqpB is a novel aquaporin identified in amoeboidal D. discoideum cells with distinctive structural features compared to other aquaporins. Key structural characteristics include:

  • The presence of an extraordinarily long intracellular loop that appears to regulate channel function

  • A cysteine residue in the selectivity filter that confers sensitivity to mercuric chloride inhibition

  • Exists in both glycosylated and non-glycosylated forms throughout all developmental stages

Unlike other characterized aquaporins, wild-type AqpB shows an unusual property of being impermeable to water, glycerol, and urea when expressed in Xenopus laevis oocytes, suggesting a tightly regulated gating mechanism .

How does AqpB expression change during different developmental stages of Dictyostelium discoideum?

Western blot analysis has demonstrated that AqpB is expressed throughout all developmental stages of D. discoideum. Unlike other D. discoideum aquaporins (WacA and AqpA) that are only expressed during late multicellular stages and in spores, AqpB shows a more constitutive expression pattern:

Developmental StageAqpB ExpressionWacA/AqpA Expression
Amoeboid (vegetative)Present (both glycosylated and non-glycosylated forms)Absent
AggregationPresentAbsent
MulticellularPresentPresent
SporePresentPresent

This expression pattern suggests that AqpB likely plays important roles in water homeostasis throughout the entire life cycle of D. discoideum, not just during specific developmental transitions .

What are the recommended methods for cloning and expressing recombinant AqpB?

For successful cloning and expression of recombinant AqpB, the following methodology is recommended:

  • Gene Amplification: PCR amplification of the AqpB gene from D. discoideum genomic DNA using specific primers designed to include appropriate restriction sites

  • Expression Vector Construction: Insertion of the amplified gene into suitable expression vectors (e.g., with GFP fusion tags for localization studies)

  • Host Systems:

    • For functional characterization: Expression in Xenopus laevis oocytes

    • For localization studies: Expression in D. discoideum amoebae using appropriate vectors

    • For structural studies: Expression in systems capable of proper post-translational modifications

When expressing AqpB-GFP fusion constructs in D. discoideum amoebae, the protein typically localizes to vacuolar structures, the plasma membrane, and lamellipodia-like membrane protrusions, suggesting multiple potential functions .

What experimental approaches can be used to investigate the novel gating mechanism of AqpB?

The discovery that wild-type AqpB is impermeable to water but becomes permeable upon truncation of its intracellular loop by 12 amino acids suggests a novel gating mechanism. To further investigate this phenomenon:

  • Site-Directed Mutagenesis Approach:

    • Perform systematic mutations along the intracellular loop to identify critical residues

    • Generate truncation mutants with varying lengths to determine the minimal sequence required for gating

    • Use cysteine scanning mutagenesis to probe structural rearrangements during gating

  • Functional Assays:

    • Express mutants in Xenopus oocytes and measure water permeability using swelling assays

    • Conduct stopped-flow light scattering measurements to determine water and solute permeability coefficients

    • Employ mercuric chloride inhibition studies to confirm involvement of cysteine residues in the water pore

  • Structural Analysis:

    • Use X-ray crystallography or cryo-EM to determine the three-dimensional structure in open and closed states

    • Apply molecular dynamics simulations to model the gating transitions

    • Implement FRET-based approaches to monitor conformational changes during gating

Studies have shown that mutational truncation by 12 amino acids of the intracellular loop induced water permeability of AqpB, and this mutant was inhibited by mercuric chloride, confirming the presence of a cysteine residue in the selectivity filter as predicted by structure models .

How can single-case experimental designs be applied to study AqpB function in osmoregulation?

Single-case experimental designs offer powerful approaches for studying AqpB function in individual cells or small populations of D. discoideum. The following methodologies can be implemented:

  • Reversal Design (A-B-A):

    • Phase A (baseline): Monitor osmoregulation in wild-type D. discoideum cells

    • Phase B (treatment): Express modified AqpB (e.g., constitutively open channel)

    • Return to Phase A: Use inducible expression systems to remove modified AqpB

  • Multiple-Baseline Design:

    • Implement staggered introduction of AqpB modifications across different cell populations

    • Monitor osmoregulation across all populations to identify treatment effects independent of time

    • Use this approach to account for potential confounding variables in the cellular environment

  • Statistical Analysis for Single-Case Designs:

    • Employ repeated measurements (at least three times in each phase)

    • Analyze data for each individual cell rather than averaging across populations

    • Use visual analysis and statistical approaches to identify functional relationships

This approach aligns with the principles outlined in Table 13.2 from source , where individual analysis can reveal important outliers or variations that might be masked in group designs .

What are the methodological challenges in distinguishing between AqpB-mediated water transport and other osmotic adaptation mechanisms in D. discoideum?

Distinguishing between AqpB-mediated water transport and other osmotic adaptation mechanisms in D. discoideum presents several methodological challenges:

  • Overlapping Mechanisms:

    • D. discoideum employs multiple mechanisms for osmoregulation, including contractile vacuole activity

    • Water flux measurement must account for both AqpB-dependent and independent pathways

  • Experimental Approaches to Overcome These Challenges:

    • Generate AqpB knockout strains using homologous recombination or CRISPR-Cas9

    • Implement REMI (Restriction Enzyme-Mediated Integration) mutagenesis for random insertional mutagenesis

    • Use specific AqpB inhibitors in combination with cell volume measurement techniques

    • Employ fluorescent probes to track water movement across membranes

  • Combined Functional Assays:

    • Measure contractile vacuole activity simultaneously with cell volume changes

    • Track intracellular pH and ion concentrations alongside water flux

    • Monitor cell motility in osmotic gradients in wild-type versus AqpB-mutant cells

Research has shown that D. discoideum constantly balances water influx through the plasma membrane with water efflux via the contractile vacuole, making it essential to employ multiple complementary techniques to isolate AqpB-specific effects .

How can Design-of-Experiments (DoE) methodology be applied to optimize recombinant AqpB expression?

Design-of-Experiments (DoE) methodology provides a powerful and efficient approach to optimize recombinant AqpB expression while minimizing the number of experiments required:

  • Factorial Design Implementation:

    • Identify key factors affecting AqpB expression (temperature, inducer concentration, media composition, etc.)

    • Create a multi-factorial design space to systematically explore combinations of these variables

    • Use response surface methodology to identify optimal conditions

  • Optimization Process Using DoE:

    • Start with a screening design to identify significant factors

    • Follow with a response surface design to optimize significant factors

    • Validate optimal conditions with confirmation runs

  • Sample DoE Design for AqpB Expression Optimization:

FactorLow LevelCenter PointHigh Level
Temperature (°C)162530
IPTG Concentration (mM)0.10.51.0
Growth MediaMinimalSemi-richRich
Post-induction Time (hours)41224

The application of DoE methodology to bioprocess optimization, as described in source , can substantially improve yields of functional recombinant proteins while reducing the experimental burden compared to one-factor-at-a-time approaches .

What are the recommended validation methods for confirming proper folding and function of recombinant AqpB?

Validating proper folding and function of recombinant AqpB requires a multi-faceted approach:

  • Structural Validation Methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis assays to probe for well-folded domains

    • Size exclusion chromatography to confirm proper oligomeric state

    • Western blot analysis to verify glycosylation state (both glycosylated and non-glycosylated forms should be detected)

  • Functional Validation Methods:

    • Xenopus oocyte swelling assays to measure water permeability

    • Mercuric chloride inhibition studies to confirm water channel function

    • Reconstitution into proteoliposomes for stopped-flow spectroscopy measurements

    • For mutated forms (e.g., truncated intracellular loop), confirm water permeability induction

  • Localization Validation:

    • Express AqpB-GFP fusion proteins in D. discoideum amoebae

    • Verify localization to expected cellular compartments (vacuolar structures, plasma membrane, and lamellipodia-like protrusions)

    • Perform co-localization studies with markers for various membrane compartments

Proper validation ensures that the recombinant protein exhibits native-like properties before proceeding with further experimental applications.

How does AqpB contribute to D. discoideum osmoregulation compared to other aquaporins?

AqpB appears to play a distinctive role in D. discoideum osmoregulation compared to other aquaporins (WacA and AqpA):

  • Developmental Expression Pattern:

    • AqpB is expressed throughout all developmental stages

    • WacA and AqpA are expressed only at late multicellular stages and in spores

    • This suggests AqpB's involvement in osmoregulation during the entire life cycle

  • Functional Differences:

    • Wild-type AqpB is impermeable to water, glycerol, and urea unless its intracellular loop is modified

    • This gating mechanism suggests a tightly regulated water channel that may be activated under specific conditions

    • The localization to vacuolar structures suggests possible involvement in contractile vacuole function

  • Evolutionary Context:

    • D. discoideum can adapt to varying osmotic conditions despite lacking a cell wall

    • Water influx through the plasma membrane is balanced by efflux via a contractile vacuole

    • AqpB may represent an evolved mechanism for fine-tuned osmoregulation in response to environmental changes

The unique properties of AqpB suggest it may function as a conditionally activated water channel that contributes to D. discoideum's ability to adapt to changing osmotic environments throughout its complex life cycle.

What is the relationship between AqpB localization and cell motility in D. discoideum?

The localization of AqpB to lamellipodia-like membrane protrusions suggests a potential role in cell motility, a critical function in D. discoideum biology:

  • AqpB Localization Pattern Relevant to Motility:

    • AqpB-GFP fusion constructs localize to the plasma membrane and lamellipodia-like membrane protrusions

    • This pattern overlaps with structures known to be involved in directed cell movement

  • Potential Mechanisms of AqpB Involvement in Motility:

    • Localized water flux may facilitate membrane protrusion formation

    • Regulated water transport could support cytoskeletal rearrangements needed for movement

    • AqpB might interact with the actin cytoskeleton or associated proteins

  • Experimental Approaches to Study AqpB in Cell Motility:

    • Compare chemotactic responses in wild-type versus AqpB-knockout D. discoideum cells

    • Analyze movement parameters in cells expressing constitutively open AqpB mutants

    • Conduct high-resolution microscopy to track AqpB localization during active cell movement

D. discoideum is a well-established model for studying cell motility, particularly chemotaxis, with cells capable of detecting and moving toward gradients of compounds like cAMP, folic acid, and pterin . The potential involvement of AqpB in this process represents an important area for further investigation.

How can recombinant antibody technology be applied to study AqpB structure and function?

Recombinant antibody (rAb) technology offers powerful tools for studying AqpB structure and function:

  • Generation of AqpB-Specific Recombinant Antibodies:

    • Use hybridoma sequencing to develop antibodies against specific AqpB epitopes

    • Apply phage display techniques to generate a panel of diverse antibodies

    • Engineer antibody fragments (Fab, scFv) for specific applications

  • Applications of AqpB-Targeting Recombinant Antibodies:

    • Immunolocalization to track native AqpB in fixed and live cells

    • Immunoprecipitation to identify AqpB-interacting proteins

    • Conformation-specific antibodies to distinguish between gated (closed) and open states

    • Functional modulation to test the effect of blocking specific domains

  • Advantages of Recombinant Antibodies for AqpB Research:

    • Renewable resource without batch-to-batch variation

    • Can be engineered for specific applications (fluorescent tagging, specific domain targeting)

    • Accessible to the entire research community through plasmid repositories

As reported in source , recombinant antibody technology has been successfully applied to various D. discoideum antigens, providing reliable reagents for labeling and characterization of proteins and subcellular compartments .

What experimental approaches are recommended for studying the interaction between AqpB and the cytoskeleton in cellular protrusions?

Given AqpB's localization to lamellipodia-like protrusions, investigating its potential interactions with the cytoskeleton requires sophisticated experimental approaches:

  • Co-localization and Interaction Studies:

    • High-resolution confocal microscopy with AqpB-GFP and cytoskeletal markers

    • Proximity ligation assays to detect protein-protein interactions in situ

    • Co-immunoprecipitation followed by mass spectrometry to identify binding partners

    • FRET/FLIM analyses to quantify direct interactions in living cells

  • Functional Perturbation Experiments:

    • Express AqpB mutants lacking potential cytoskeleton-binding domains

    • Treat cells with cytoskeleton-disrupting drugs and observe effects on AqpB localization

    • Implement optogenetic approaches to rapidly modulate AqpB activity in specific cellular regions

  • Dynamic Analysis Methods:

    • Use fluorescence recovery after photobleaching (FRAP) to measure AqpB mobility

    • Implement live-cell imaging during chemotaxis to correlate AqpB dynamics with protrusion formation

    • Apply super-resolution microscopy techniques (PALM/STORM) to visualize nanoscale organization

D. discoideum is a leading model organism for studying the components of the actin microfilament system and their dynamic interactions during processes like chemotaxis and cell motility , making it ideal for investigating potential AqpB-cytoskeleton interactions.

How should researchers address data variability when measuring AqpB-mediated water transport?

Addressing data variability in AqpB-mediated water transport measurements requires rigorous statistical approaches and experimental controls:

  • Sources of Variability in AqpB Functional Assays:

    • Expression level differences between experiments

    • Variation in post-translational modifications

    • Heterogeneity in membrane incorporation

    • Background permeability of experimental systems

  • Statistical Approaches for Robust Analysis:

    • Use appropriate sample sizes based on preliminary variance estimates

    • Apply the Benjamini-Hochberg procedure for controlling false discovery rate (as described in source )

    • Implement multivariate regression to account for covariates

    • Consider non-parametric tests (e.g., Wilcoxon rank-sum test) when data doesn't meet normality assumptions

  • Recommended Experimental Controls:

    • Include negative controls (non-expressing cells) in each experiment

    • Use positive controls (cells expressing known aquaporins) for comparison

    • Perform technical replicates (multiple measurements of the same sample)

    • Conduct biological replicates (independent preparations of the expression system)

Careful attention to both experimental design and statistical analysis, as outlined in source , will help ensure robust and reproducible results when characterizing AqpB-mediated water transport .

What approaches can resolve contradictory findings about AqpB function in different experimental systems?

When facing contradictory findings about AqpB function across different experimental systems, systematic troubleshooting and integrative approaches are essential:

  • Systematic Evaluation of Experimental Variables:

    • Expression system differences (oocytes vs. mammalian cells vs. reconstituted proteoliposomes)

    • Buffer composition and osmolarity variations

    • Temperature effects on channel gating

    • Post-translational modifications in different systems

  • Integrative Experimental Approach:

    • Cross-validate findings using multiple independent techniques

    • Implement a Design-of-Experiments approach to systematically test variables

    • Develop computational models to reconcile seemingly contradictory results

    • Collaborate with groups using different systems to standardize protocols

  • Single-Case Experimental Designs:

    • Apply reversal design (A-B-A) methodology to confirm causality

    • Use multiple-baseline designs to account for temporal variables

    • Analyze individual experimental units rather than only group averages

As demonstrated in Table 13.2 from source , individual analysis can reveal important patterns that might be obscured in grouped analysis, particularly when investigating complex phenotypes like those associated with AqpB function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.