Recombinant Dictyostelium discoideum Aquaporin C (wacA)

Shipped with Ice Packs
In Stock

Description

Gene Expression and Developmental Regulation

The wacA gene is tightly regulated during Dictyostelium development:

  • Temporal Expression: mRNA first detected at 12 hours of multicellular development and persists through later stages .

  • Spatial Localization: Exclusively expressed in prespore cells, absent in prestalk cells (confirmed via in situ hybridization) .

  • Knockout Phenotype: Gene disruption via homologous recombination showed no observable defects in spore formation or osmotic resistance .

Functional Studies and Challenges

Despite structural similarity to aquaporins, functional water channel activity has not been demonstrated:

Experimental SystemFindingsSource
Xenopus laevis oocytesWild-type wacA showed no water, glycerol, or urea permeability
Dictyostelium mutantsNo impact on spore viability or contractile vacuole function
Mutational analysisTruncation of a 12-amino-acid intracellular loop in AqpB (a homolog) restored water permeability, suggesting gating mechanisms may regulate wacA

Recombinant Protein Applications

Recombinant wacA is commercially available for research use, with specifications including:

ParameterDetail
Expression SystemE. coli or similar recombinant hosts
Purity>90% (SDS-PAGE verified)
Storage-20°C in Tris-based buffer with 50% glycerol; avoid freeze-thaw cycles
ApplicationsAntibody production, enzymatic assays, structural studies

Research Implications

The absence of observable phenotypes in wacA knockout strains suggests functional redundancy or alternative roles beyond osmoregulation . Its prespore-specific expression hints at a developmental role, potentially in spore maturation or environmental sensing. Comparative studies with AqpB—a gated, constitutively expressed aquaporin in Dictyostelium—highlight evolutionary diversity in aquaporin regulation .

Key Unresolved Questions

  • Does wacA transport substrates other than water (e.g., ions, small metabolites)?

  • What molecular signals regulate its prespore-specific expression?

  • Are there compensatory mechanisms in wacA knockout strains?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation if feasible.
Synonyms
wacA; DDB_G0280537; Aquaporin C; Aquaporin-like protein wacA; Water channel protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
wacA
Target Protein Sequence
MPFLHLFTPYTNADNTKLILRVNESRLRLFTRQLLAEFFGTLFVVYIVSGSTLAANFAVSDPIVRVCLICLVQGFAFAAIIWSISGISGCQLNPAVTVGCVTTGRMGILNGIAFIIFQCVGALVGAGMMKASLPTFYERDLSATTLATGVNVARGFFLEMVTTSFLVFVVLGVAVYNEWDPKISRVAPLAIGCAVIAGVGFLNLFTGGSLNPARSFGPAVFSDTWHRHYIYWFGPICGGIIAGLFWRIFLSEKVLLIDRPYTDFHRSTYGTATK
Uniprot No.

Target Background

Function
May form a water-specific channel.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is wacA and how was it initially identified?

wacA is a gene in Dictyostelium discoideum that encodes a 30 kDa protein with significant homology to the major intrinsic protein (MIP) family of membrane transporters. It was initially isolated as a cDNA that showed 34% identity to an aquaporin from Cicadella viridis when compared against public databases. The gene was subsequently characterized through isolation and analysis of genomic fragments carrying the Dictyostelium gene, which researchers named wacA.

What is the developmental expression pattern of wacA in Dictyostelium discoideum?

The wacA gene exhibits strict developmental regulation in Dictyostelium discoideum. Genomic probes used to recognize wacA mRNA at various developmental stages revealed that the gene's mRNA first appears approximately 12 hours into development and persists throughout the remainder of the developmental cycle. In situ hybridization studies of whole mounts prepared at 15 hours of development demonstrated that wacA mRNA accumulates exclusively in prespore cells while being absent from prestalk cells.

How does wacA compare to other known aquaporins in Dictyostelium?

Three aquaporins have been identified in Dictyostelium discoideum: wacA, AqpA, and AqpB. While wacA and AqpA are predominantly expressed during late multicellular developmental stages and in spores, they are notably absent in amoebae. In contrast, AqpB appears to be expressed throughout all developmental stages, including the amoeboidal phase. This expression pattern suggests different functional roles for these aquaporins during the Dictyostelium life cycle.

Has water permeability been demonstrated for wacA?

Despite wacA being classified as a putative aquaporin based on sequence homology, direct experimental evidence of its water permeability function remains limited. Research indicates that while wacA has been cloned, actual water permeability has not been conclusively demonstrated. This stands in contrast to other Dictyostelium aquaporins like AqpB, for which water permeability has been studied through expression in systems such as Xenopus laevis oocytes followed by functional characterization.

What techniques can be used to study wacA expression during Dictyostelium development?

Multiple complementary techniques have proven effective for studying wacA expression:

  • Northern blot analysis: Using genomic probes to detect wacA mRNA isolated at various stages of development to establish temporal expression patterns.

  • In situ hybridization: Performed on whole mounts prepared at specific developmental time points (e.g., 15 hours) to determine spatial expression patterns within the multicellular structure.

  • Western blot analysis: Can be used to detect the protein product, though this approach may require generation of specific antibodies against wacA.

  • GFP fusion constructs: Though not specifically reported for wacA, fluorescent protein fusions have been successfully used with other Dictyostelium aquaporins like AqpB to study subcellular localization.

How can recombinant wacA protein be produced for functional studies?

While the search results don't specifically detail recombinant wacA production, insights can be drawn from approaches used with other aquaporins:

  • Heterologous expression systems: Xenopus laevis oocytes have been successfully used to express and functionally characterize Dictyostelium aquaporins. This system allows for water permeability measurements through osmotic swelling assays.

  • Expression in Dictyostelium: Transformation of Dictyostelium cells with constructs where the wacA cDNA is controlled by constitutive or inducible promoters can enable expression throughout development or in specific cell types.

  • Bacterial or yeast expression systems: These could potentially be used for larger-scale protein production, though membrane proteins often present challenges for recombinant expression.

What methods are recommended for disrupting the wacA gene to study its function?

Homologous recombination has been successfully employed to disrupt the wacA gene in Dictyostelium. This approach involves:

  • Construction of a disruption vector: Containing wacA sequences flanking a selectable marker.

  • Transformation into Dictyostelium: Using established transformation protocols for this organism.

  • Selection of transformants: Typically using antibiotics corresponding to the resistance marker in the disruption vector.

  • Verification of disruption: Through PCR, Southern blotting, and RT-PCR to confirm the absence of intact wacA gene and transcript.

How does wacA compare to aquaporins in other organisms?

wacA shows significant similarity to other members of the major intrinsic protein (MIP) family of membrane transporters across species. The most closely related protein identified in public databases is an aquaporin from Cicadella viridis, showing 34% sequence identity. This moderate level of conservation suggests that while wacA maintains core structural elements common to aquaporins, it may have evolved specific functional adaptations unique to Dictyostelium's lifecycle and environmental challenges.

What insights can heterologous expression of aquaporins in Dictyostelium provide?

Dictyostelium has proven to be a valuable model system for studying aquaporin function across species. For example, expression of the Arabidopsis thaliana rd28 aquaporin in Dictyostelium cells demonstrated that:

  • Plant aquaporins can function in the cells of other organisms, confirming functional conservation.

  • Cells expressing the plant aquaporin showed increased sensitivity to osmotic stress, swelling rapidly and bursting when shifted to low-osmotic-strength buffer.

  • Expression of aquaporins specifically in prespore cells disrupted normal development and fruiting body formation.

These findings highlight Dictyostelium's utility as a heterologous system to test aquaporin activity and determine effects on osmotic adaptation and cell signaling.

How might the study of wacA contribute to understanding cell differentiation in Dictyostelium?

The prespore-specific expression of wacA suggests it may play a role in the differentiation pathway of prespore cells or in maintaining their cellular identity. Although disruption studies showed no obvious phenotype, more subtle effects might exist:

  • Cell-type specification: wacA could be part of the gene expression program that defines prespore cell identity.

  • Intercellular signaling: As demonstrated with other aquaporins, osmotic changes in prespore cells can affect signaling to prestalk cells, suggesting potential roles in coordinating multicellular development.

  • Terminal differentiation: During spore formation, prespore cells undergo dehydration, a process where aquaporins might participate, though functional redundancy may mask the contribution of any single aquaporin.

What approaches can resolve the apparent contradiction between prespore-specific expression and lack of phenotype in wacA disruption?

This apparent contradiction presents an interesting research challenge. Several sophisticated approaches could help resolve this issue:

  • Double or triple aquaporin knockouts: Generating strains lacking multiple aquaporins (wacA, AqpA, AqpB) could reveal redundant functions.

  • Stress conditions: Testing wacA mutants under various environmental stresses beyond standard laboratory conditions, including extreme osmotic challenges or natural soil conditions.

  • Single-cell analysis: Examining individual cell behaviors during development using advanced microscopy techniques might reveal subtle phenotypes not apparent at the population level.

  • Transcriptomics: RNA-seq comparing wild-type and wacA-disrupted strains during development could identify compensatory changes in gene expression.

How can structural modifications be used to study wacA gating mechanisms?

Drawing from studies of other Dictyostelium aquaporins like AqpB, several approaches could be applied to wacA:

  • Truncation analysis: Systematic truncation of terminal regions or internal loops could identify domains involved in channel gating.

  • Site-directed mutagenesis: Targeted modification of specific amino acids, particularly in the selectivity filter or putative gating regions.

  • Chimeric proteins: Creating fusion proteins between wacA and other functionally characterized aquaporins to identify domains responsible for specific properties.

  • Structural modeling: Computational approaches to predict the structure and identify potential gating mechanisms, followed by experimental validation.

Modification TypeExample ApproachPotential Insight
Terminal truncationN-terminal deletion seriesRole in channel regulation
Loop modificationTruncation of intracellular loopsIdentification of gating elements
Point mutationsCysteine substitutionMercury sensitivity and pore structure
Chimeric constructswacA/AqpB fusion proteinsDomain-specific functions

What are the key considerations for expressing recombinant wacA in heterologous systems?

Expressing membrane proteins like wacA presents several challenges:

  • Expression system selection: Xenopus laevis oocytes have been successfully used for functional studies of Dictyostelium aquaporins, offering advantages for water permeability measurements through swelling assays.

  • Protein topology and folding: Ensuring proper membrane insertion and folding is critical for functional studies. Addition of tags at specific locations rather than termini might preserve functionality.

  • Post-translational modifications: Evidence from AqpB suggests Dictyostelium aquaporins may undergo glycosylation, which might be important for function or localization.

  • Functional assays: Developing reliable assays to measure water, glycerol, or other substrate permeability is essential for characterizing channel properties.

How can the developmental regulation of wacA be leveraged in experimental design?

The tight developmental regulation of wacA expression offers unique experimental opportunities:

  • Promoter utilization: The wacA promoter could be used to drive prespore-specific expression of other genes of interest.

  • Developmental markers: wacA expression could serve as a marker for the prespore cell fate and developmental timing.

  • Inducible systems: Creating chimeric regulatory systems incorporating elements of the wacA promoter could enable fine temporal control of gene expression.

  • Developmental synchronization: Techniques to synchronize development could be optimized using wacA expression as a temporal marker.

What are the best approaches for studying potential roles of wacA in spore osmoresistance?

Despite initial findings showing no obvious role in osmoresistance, more sophisticated approaches might reveal subtle functions:

  • Quantitative osmotic challenge assays: Using precise gradients of osmotic stress rather than binary viable/non-viable measurements.

  • Time-lapse microscopy: Monitoring spore responses to osmotic changes in real-time at the single-cell level.

  • Combinatorial gene disruption: Creating strains with multiple aquaporin genes disrupted to address potential functional redundancy.

  • Natural environment simulation: Testing spore viability under conditions mimicking the natural soil environment with cycling wet/dry periods.

How might CRISPR-Cas9 technology enhance wacA functional studies?

While not specifically mentioned in the search results, CRISPR-Cas9 gene editing offers several advantages for studying wacA:

  • Precise gene editing: Creating specific mutations or truncations without disrupting the entire gene.

  • Endogenous tagging: Adding fluorescent or affinity tags to the endogenous wacA locus to study the protein under native regulation.

  • Conditional knockouts: Developing systems for inducible or cell-type specific disruption of wacA.

  • Multiplexed editing: Simultaneously modifying multiple aquaporin genes to address functional redundancy.

What potential roles might wacA play in intercellular signaling during Dictyostelium development?

Research with other aquaporins suggests potential signaling roles for wacA:

  • Osmotic stress signaling: Changes in cellular osmotic status can trigger signaling pathways affecting development.

  • Prespore to prestalk communication: Expression of the Arabidopsis aquaporin rd28 in prespore cells affected stalk differentiation, suggesting prespore cells signal to prestalk cells. wacA might participate in similar communication.

  • Small molecule transport: Some aquaporins can transport small signaling molecules in addition to water, potentially facilitating intercellular communication.

  • Mechanical signaling: Osmotic changes affect cell volume and shape, which could influence mechanical aspects of development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.