Recombinant Dictyostelium discoideum Arrestin domain-containing protein A (adcA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
adcA; DDB_G0292924; Arrestin domain-containing protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-580
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
adcA
Target Protein Sequence
MNYQVTVSGDPELAQESVDFVSSGFGNMSMNVNTTSSHHHHHSNSGNAEVSFNGGFGMPN MTMEVKETHSGHHHHHSNGGNAEISINSGFGMPSMTMSVTDSNSGHHHHHHKESASVNLS LGGIVGAVVGAVTGGVMIDGRNRIWVQLNQSSYVGGDIISGTIEMDCIVPFFAKGVIVKV KGFERLWLQELRTETEGEGSNKRTVYKTIDHKENKEFFKSTIVVYPQAGTVNCGHYSFPF SYQLPSDLPGTFCHDGKDAMGAYSAKILYKCKATVDVAHKHDLKSTTKLIINEKCGELVQ PSFAENKKSFMLTKGKLHVKTWLNKNAYFPGETLVAKMKANNTSIKPTRKISLVVHHTMQ LKTRLYHRCITNAIYKQQYDGFQPCFYGKRYLPFSIPVDLKPSSSLGKHITSSYLLELEC DIPMAIDLSVTLPLTLFAPQFLYSTVPSQPPGTPLPPDVSYRHPWEGDEHATACRKCNKG FSLFARKHHCRHCMKIFCDKCTSTKTTITKLAYPKPVRVCEECYPIATQGGNKYQSAKLM AAQYQASLNAYYAQYASLYPQIYPDQQQQQQQPSAPPQQY
Uniprot No.

Target Background

Gene References Into Functions
  1. AdcA, an arrestin-domain containing protein, functions as a stress response element. [PMID: 24267687]
Database Links
Protein Families
Arrestin family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the domain architecture of AdcA in Dictyostelium discoideum?

AdcA exhibits a complex multi-domain architecture that extends beyond the canonical arrestin fold. Its structure includes:

  • An N-terminal extension featuring a histidine-rich (H) domain with three ~30-amino acid repeats, each containing 5-6 contiguous histidine residues (approximately 80% homology between repeats)

  • A hydrophobic region (Φ domain) consisting of a 23-amino acid sequence (residues 119-138) that forms a predicted amphipathic α-helix

  • A central arrestin core comprised of N- and C-domains with β-sheet sandwich structure

  • A C-terminal FYVE zinc-finger domain that binds specifically to PI(3)P

  • A tyrosine-rich region (Y domain) at the extreme C-terminus

The modeled structure of the arrestin core closely resembles that of mammalian β-arrestin 1 despite limited sequence homology, suggesting functional conservation of this scaffold structure. The FYVE domain contains the characteristic eight zinc-coordinating cysteine residues and inositol phospholipid binding motifs (WxxD, R(R/K)HHCR, and RVC signatures), sharing 42% identity and 63% similarity with the human EEA1 FYVE domain .

How does the subcellular localization of AdcA differ from canonical arrestins?

Unlike mammalian β-arrestins that primarily function at the plasma membrane, AdcA exhibits distinct subcellular distribution patterns:

  • AdcA is predominantly enriched on the membranes of early macropinosomes and phagosomes

  • Recruitment occurs immediately after vesicle closure and detachment from the plasma membrane

  • Only trace amounts of AdcA are detected at the plasma membrane itself

  • This localization pattern is highly dependent on a functional FYVE domain, which targets the protein to PI(3)P-enriched endosomal membranes

The unique targeting of AdcA to early endocytic compartments suggests specialized functions in these vesicular pathways compared to canonical arrestins, potentially involving different activation mechanisms and signaling partners.

What protein interactions has AdcA been confirmed to participate in?

The most well-characterized protein interaction for AdcA is with the small GTPase ArfA:

  • AdcA binds directly to ArfA, the sole member of the Arf family in Dictyostelium (equivalent to mammalian Arf1-6)

  • Interaction occurs specifically via the C-domain of the arrestin core (AdcA C)

  • Binding is nucleotide-dependent, with strong preference for GDP-bound ArfA

  • GTP-bound ArfA (stabilized by GTPγS) shows markedly reduced interaction with AdcA

This nucleotide-dependent interaction parallels the relationship between mammalian β-arrestin 2 and ARF6, suggesting evolutionary conservation of arrestin-Arf functional coupling in membrane trafficking pathways.

What expression systems are most effective for producing recombinant AdcA?

Based on experimental evidence and protein characteristics, the following expression approaches are recommended:

Expression SystemSuitabilityConsiderations
E. coliModerateFull-length AdcA shows limited solubility; domain-specific constructs recommended
DictyosteliumExcellentHomologous expression preserves proper folding and post-translational modifications
Mammalian cellsVariableMay require codon optimization; useful for functional studies with mammalian partners
Cell-free systemsLimitedUseful for domain-specific studies but challenging for full-length protein

When expressing in E. coli, note that the full arrestin core (AdcA NC) has been reported as insoluble when fused to GST, while the C-domain alone (GST-AdcA C) can be successfully purified . For functional studies, expression in Dictyostelium with appropriate tags (GFP, RFP, myc) has proven successful and allows observation of physiological localization patterns.

How can researchers experimentally verify FYVE domain functionality in recombinant AdcA?

The functionality of the FYVE domain can be assessed through several complementary approaches:

  • Lipid overlay assays: Purified recombinant protein or its FYVE domain can be tested for binding to immobilized phosphoinositides on membrane strips. Functional FYVE domains show strong and selective binding to PI(3)P spots .

  • Intrinsic fluorescence measurements: Changes in tryptophan fluorescence upon addition of PI(3)P-containing liposomes can quantitatively measure binding affinities. The FYVE domain typically contains conserved tryptophan residues within the WxxD motif that respond to lipid binding.

  • Subcellular localization studies: Expression of GFP-tagged full-length AdcA and FYVE domain mutants in Dictyostelium cells allows visualization of endosomal recruitment. Functional FYVE domains show characteristic rim-like staining of early endosomes, while point mutations in critical residues (such as in the R(R/K)HHCR motif) disrupt this localization .

  • Co-localization with PI(3)P sensors: Double labeling with established PI(3)P markers like 2xFYVE-GFP can confirm proper targeting to PI(3)P-enriched membranes.

What methods can be employed to study the interaction between AdcA and ArfA?

Several biochemical and cellular approaches can effectively characterize the AdcA-ArfA interaction:

  • Pull-down assays: Using purified GST-tagged AdcA domains and His-tagged ArfA in different nucleotide-bound states (GDP, GTP, or nucleotide-free). As demonstrated experimentally, GST-AdcA C binds ArfA-His₆ preferentially in GDP-bound or nucleotide-free states, while GTPγS strongly reduces binding .

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics and affinities between purified AdcA and ArfA in different nucleotide states.

  • Yeast two-hybrid assays: To map interaction domains and screen for critical residues involved in binding.

  • FRET/BiFC analysis: In live Dictyostelium cells to visualize interactions in their physiological context.

  • Co-immunoprecipitation: From Dictyostelium cell lysates expressing tagged versions of both proteins to confirm interaction under physiological conditions.

The nucleotide-dependence of this interaction makes it crucial to carefully control the GTP/GDP loading state of ArfA in all experimental setups.

How might mutations in the arrestin core affect AdcA's ability to bind ArfA?

Based on structural modeling and known arrestin-effector interactions, several approaches can be taken to investigate this question:

  • Structure-guided mutagenesis: Target conserved residues in the AdcA C-domain based on homology modeling with β-arrestin structures. Focus on:

    • Residues in predicted binding interfaces (particularly exposed hydrophobic and charged patches)

    • Regions equivalent to the "activated" conformation in canonical arrestins

    • Conserved structural elements that maintain the arrestin fold

  • Chimeric proteins: Create chimeras between AdcA and other arrestin family members (AdcB-F) that may not bind ArfA, to map specificity determinants.

  • In vitro binding assays: Test mutant constructs for ArfA binding using GST pull-down or surface plasmon resonance to quantify affinity changes.

  • Cellular phenotypes: Express mutants in adcA-null Dictyostelium and assess effects on endocytic trafficking and ArfA-dependent processes.

Unlike canonical arrestins, AdcA lacks an obvious polar core of buried salt bridges between the N- and C-domains and C-terminal tail . This suggests a different mode of activation and regulation than in mammalian β-arrestins, which should be considered when designing mutation strategies.

What is the significance of the histidine-rich repeats in the AdcA N-terminal region?

The unique histidine-rich (H) domain with triple repeats in AdcA has no known homologs outside Dictyostelium species, suggesting specialized functions:

FeaturePotential FunctionExperimental Approach
Poly-histidine clusters (5-6 contiguous His)Metal ion coordinationMetal-affinity chromatography with different divalent cations
Triple repeat structure (80% homology)Multivalent binding to partnersTruncation constructs to test functional redundancy
Conservation in D. discoideum and D. purpureumSpecies-specific adaptationsComparative analysis across Dictyostelium species
pH-sensitive protonationpH sensing in endocytic pathwayAssess binding properties across pH range 5.0-7.5

To investigate these functions, researchers should consider:

  • Creating truncation mutants lacking one, two, or all three repeats to assess functional consequences

  • Testing the metal-binding properties using isothermal titration calorimetry with various metal ions

  • Examining pH-dependent conformational changes using circular dichroism spectroscopy

  • Identifying potential binding partners through pull-down assays coupled with mass spectrometry

  • Investigating localization changes of H-domain mutants during endocytic trafficking

The presence of this domain in D. purpureum as a quadruple repeat, but its absence in P. pallidum , suggests evolutionary divergence that may correlate with specific functional adaptations.

How does cell density affect the expression and function of AdcA in Dictyostelium?

Cell density is a critical parameter in Dictyostelium biology that influences developmental transitions and signaling networks:

  • Expression regulation: During Dictyostelium development, cells aggregate through cAMP signaling, which is affected by cell density. Research indicates that in areas of higher cell density, stable activity centers spontaneously form with characteristic oscillation frequencies . Monitoring AdcA expression and phosphorylation state across developmental stages at different cell densities may reveal density-dependent regulation.

  • Functional implications: The endocytic activity of Dictyostelium cells changes dramatically during development and aggregation. Since AdcA localizes to early endocytic compartments, its function may be modulated by density-dependent changes in endocytic flux.

  • Experimental design considerations: When studying AdcA, researchers should:

    • Standardize cell density in experiments (typically 1-5 × 10^6 cells/mL for vegetative cells)

    • Account for density effects when comparing results across studies

    • Monitor AdcA behavior at the transition from single cells to aggregation streams

    • Consider the potential role of AdcA in density sensing mechanisms

What genetic approaches can be used to study AdcA function in Dictyostelium?

Dictyostelium offers several genetic tools for functional studies of AdcA:

  • Gene knockout strategies: The high rate of homologous recombination in Dictyostelium (approximately 0.1% per kilobase) facilitates targeted disruption of adcA. Researchers should:

    • Design targeting vectors with appropriate selectable markers

    • Screen transformants by PCR and confirm by Southern blotting

    • Assess phenotypic consequences in endocytosis, phagocytosis, and development

  • Domain-specific mutants: Rather than complete deletion, researchers can introduce specific mutations to analyze domain functions:

    • FYVE domain mutations that abolish PI(3)P binding

    • Arrestin core mutations affecting ArfA interactions

    • Histidine-rich repeat deletions or substitutions

  • Complementation analysis: For functional rescue studies, researchers can use:

    • Expression of wild-type AdcA in knockout cells

    • Domain swaps with other arrestin family members

    • Expression of AdcA orthologs from other species

  • Sexual genetics: While challenging, the sexual cycle in Dictyostelium can be exploited using strains like A2Cycr and WS205, which show high recombination rates . This approach could generate strains with novel combinations of mutations affecting AdcA and interacting partners.

Can recombinant AdcA be used as a research tool for studying endocytic pathways?

The unique properties of AdcA make it valuable for investigating endocytic processes:

  • As a PI(3)P biosensor: The FYVE domain of AdcA specifically binds PI(3)P on early endosomes. Isolated FYVE domains or full-length AdcA tagged with fluorescent proteins can serve as reporters for PI(3)P dynamics during endocytosis, similar to established tools like 2xFYVE-GFP but with potential advantages based on the Dictyostelium-specific optimization.

  • For ArfA activity monitoring: The preferential binding of AdcA to GDP-bound ArfA could be exploited to develop biosensors that report on ArfA nucleotide state in cells, complementing existing Arf activity probes.

  • As an early endosome marker: In both Dictyostelium and heterologous systems, fluorescently tagged AdcA can serve as a marker for early endocytic compartments, particularly useful in live-cell imaging studies.

  • For pull-down applications: Recombinant AdcA domains can be used to isolate and identify novel interacting proteins from cell lysates, potentially revealing new components of endocytic pathways.

How might the study of AdcA contribute to understanding human arrestin biology?

Despite divergent features, comparative analysis of AdcA and human arrestins offers valuable insights:

  • Evolutionary perspective: AdcA represents an early branch point in arrestin evolution, displaying both conserved features (arrestin fold, interaction with small GTPases) and lineage-specific adaptations (FYVE domain, histidine-rich repeats). This provides a broader evolutionary context for understanding arrestin function.

  • Novel domain combinations: The unique architecture of AdcA, particularly the FYVE domain extension, suggests functional capabilities not present in canonical arrestins. These may inspire investigation of similar functionalities in human arrestin-related proteins.

  • Endosomal signaling: While canonical arrestins primarily regulate plasma membrane receptors, AdcA's endosomal localization highlights the importance of arrestin-like proteins in post-endocytic signaling, an emerging area in human cell biology.

  • Therapeutic implications: Understanding the mechanistic details of how AdcA functions in endocytic pathways may inspire new approaches for targeting human arrestin-dependent processes in disease contexts.

Key research directions include comparing the binding partners of AdcA with those of human arrestins, analyzing the functional consequences of introducing AdcA domains into human arrestins, and investigating whether human arrestin-domain containing proteins might have undiscovered associations with phosphoinositides.

What strategies can overcome solubility issues when expressing recombinant AdcA?

Researchers working with recombinant AdcA often encounter solubility challenges, particularly with the full-length protein:

  • Domain-specific expression: As observed experimentally, the full arrestin core (AdcA NC) can be insoluble when fused to GST, while individual domains show better solubility . Consider expressing functional domains separately:

    • FYVE domain (typically well-behaved in bacterial expression)

    • Arrestin C-domain (demonstrated solubility as GST fusion)

    • Histidine-rich region (likely highly soluble due to charged nature)

  • Solubility tags and conditions:

    • Test multiple fusion tags (MBP, SUMO, TRX) known to enhance solubility

    • Optimize expression temperature (16-20°C often improves folding)

    • Use specialized E. coli strains (Rosetta, Arctic Express) for problematic constructs

    • Include stabilizing additives in lysis buffers (glycerol, low concentrations of non-ionic detergents)

  • Refolding approaches: For inclusion body-forming constructs, controlled denaturation and refolding may yield functional protein.

  • Alternative expression systems: Consider baculovirus-infected insect cells or cell-free systems for challenging constructs.

How can researchers distinguish between the effects of AdcA and other arrestin-domain containing proteins in Dictyostelium?

Dictyostelium contains six arrestin-domain containing proteins (AdcA-F) with potential functional overlap:

  • Gene-specific knockouts: Generate single and combined knockouts of adc genes to identify unique and redundant functions.

  • Domain specificity: Leverage the unique domain architecture of AdcA (particularly the FYVE domain and histidine-rich repeats) to design experiments targeting AdcA-specific functions.

  • Expression patterns: Analyze the temporal and spatial expression profiles of all Adc proteins during development to identify differential regulation.

  • Rescue experiments: Test the ability of various Adc proteins to complement adcA knockout phenotypes, revealing functional equivalence or specificity.

  • Protein-specific antibodies: Develop antibodies against unique regions of each Adc protein for immunolocalization and biochemical studies without cross-reactivity.

  • Interactome analysis: Compare the binding partners of different Adc proteins to identify unique and shared interactors, informing functional distinction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.