Recombinant Dictyostelium discoideum ATP synthase subunit a (atp6)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Dictyostelium discoideum ATP synthase subunit a (ATP6) refers to a bioengineered protein derived from the slime mold D. discoideum. This subunit is a component of mitochondrial ATP synthase (Complex V), which catalyzes ATP synthesis via proton translocation across the inner mitochondrial membrane. The recombinant form is produced in Escherichia coli and includes an N-terminal histidine (His) tag for purification and detection .

Key Features

  • Gene Origin: atp6 gene (UniProt Q27559).

  • Protein Length: 244 amino acids (aa) (1–244) .

  • Host System: E. coli for expression .

  • Applications: Structural studies, immunoassays (e.g., ELISA), and disease modeling .

2.1. Role in ATP Synthase

ATP synthase subunit a (ATP6) is part of the F₀ sector, forming a proton channel with subunit c (encoded by ATP9 in other organisms). This subunit interacts with the stator arm and peripheral stalk to facilitate proton translocation and ATP synthesis .

FeatureDescription
Proton ChannelSubunit a and c-ring (10 c-subunits) transport protons across the membrane .
Stator-Stalk InteractionBinds to subunits b, d, e, and the peripheral stalk to stabilize the complex .
DimerizationCritical for ATP synthase oligomerization and mitochondrial morphology .

3.1. Expression System

The recombinant ATP6 is expressed in E. coli, leveraging its robust protein production capabilities. The His-tag enables affinity chromatography for purification .

4.1. Immunoassays

The recombinant ATP6 is used in ELISA kits (e.g., CSB-CF638892DKK) for quantifying protein levels in mitochondrial or cellular extracts .

4.3. Disease Modeling

Mutations in ATP6 (e.g., m.8993 T > G in humans) disrupt proton transport, leading to mitochondrial diseases. The recombinant protein aids in studying such mutations’ biochemical impacts .

5.1. Proton Channel Dysfunction

Mutations in ATP6 (e.g., L156R in humans) impair proton translocation, reducing ATP synthesis by 90% while maintaining ATP hydrolysis . In D. discoideum, ATP6 knockdown disrupts mitochondrial respiration and activates AMPK, mimicking energy stress responses .

5.2. Complex Assembly

  • Subunit Interactions: ATP6 requires subunits A6L and b/d for dimerization and stability .

  • Cox Assembly Link: A 9205ΔTA mutation in ATP6 disrupts COX3 mRNA processing, highlighting cross-talk between ATP synthase and cytochrome c oxidase biogenesis .

6.1. Mitochondrial Disorders

ATP6 mutations are linked to NARP syndrome, Leigh syndrome, and retinitis pigmentosa . Recombinant ATP6 enables screening for these mutations and testing therapeutic interventions .

6.2. Drug Development

The protein serves as a target for modulators of mitochondrial ATP synthesis, particularly in neurodegenerative and metabolic diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
atp6; DDB_G0294014; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
atp6
Target Protein Sequence
MKSLFEQFEIDLYCIIITRFFDISITTITVYLGLLMVIVIGMYKVSLYKATIIGGNNWQH IGEMIYEFVVDLIIEQVGKPGILFFPFIMSLFLFVLTLNVMGLIPLSFTVTGQLLVTFTL AITIMIGITIWGFRIHGIKFLNIFVPSGIEPWLLPLLVFIEIMSYVLRPISLAVRLFANM LAGHLLIHIIGVAAIYLMQFYFIGILPWICVIAFMFLELGIAFLQAYVFVLLTLIYIANI INLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, driven by electron transport complexes in the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of subunit a (atp6) in Dictyostelium discoideum ATP synthase?

Subunit a (atp6) is a critical mitochondrially-encoded component of the F0 sector of ATP synthase in Dictyostelium discoideum. It plays an essential role in proton translocation across the inner mitochondrial membrane, which is necessary for the synthesis of ATP. The subunit forms part of the membrane-embedded portion of ATP synthase and interacts directly with the Atp9p ring structure. This interaction creates the proton channel, facilitating the conversion of the proton gradient energy into mechanical energy that drives ATP synthesis. Importantly, atp6 incorporation represents a late assembly event in ATP synthase biogenesis, likely because premature association of atp6 with the Atp9p ring could cause an unregulated proton leak that would dissipate the mitochondrial membrane potential .

How does ATP synthase assembly differ in Dictyostelium compared to other eukaryotes?

ATP synthase assembly in Dictyostelium follows the general eukaryotic pattern but with some distinct characteristics. The process begins with the independent assembly of the F1 sector, which involves an initial chaperone-dependent association of α and β subunits into a hexamer. This assembly can occur independently of the F0 sector . While the core assembly mechanism is conserved, Dictyostelium appears to have some unique regulatory features. For instance, proteomic analyses of Dictyostelium autophagy mutants have shown alterations in ATP synthase subunit expression, suggesting interconnections between ATP synthase assembly and cellular quality control mechanisms . Additionally, although only the β-subunit (AtpB) has been confidently identified in some mass spectrometry studies of Dictyostelium, structural predictions using AlphaFold 3 support the presence of the canonical α3β3γ arrangement typical of F1 ATPase .

How is expression of atp6 regulated at the translational level in Dictyostelium?

The expression of atp6 in Dictyostelium, like in other eukaryotes, appears to be regulated by a translational activation mechanism involving the F1 sector of ATP synthase. Research in yeast has demonstrated that translation of Atp6p and Atp8p is contingent on the presence of assembled (though not necessarily catalytically active) F1 ATPase . This creates a regulatory checkpoint ensuring balanced output of nuclear and mitochondrially encoded ATP synthase components.

The methodology to investigate this regulatory mechanism typically involves:

  • Creating mutants lacking specific F1 subunits

  • Analyzing translation of mitochondrially encoded proteins using pulse-labeling with radiolabeled amino acids

  • Quantifying protein synthesis by electrophoretic separation and autoradiography

  • Confirming mRNA levels through northern blotting

This regulatory mechanism likely exists in Dictyostelium as well, as it represents an evolutionary conserved strategy to prevent accumulation of incomplete ATP synthase complexes that could be deleterious to mitochondrial function .

What factors influence atp6 expression during Dictyostelium development?

During Dictyostelium development, atp6 expression is subject to complex regulation influenced by both developmental stage and environmental conditions. Proteomic analyses have revealed that subunits of the ATP synthase, including components related to the F0 sector containing atp6, show differential expression during the transition from growth to development .

Key factors influencing atp6 expression include:

FactorEffect on atp6 ExpressionMeasurement Method
Nutrient availabilityIncreases during starvationQuantitative proteomics (TMT)
Developmental stageUpregulated during specific developmental phasesRNAseq and proteomics
Oxidative stressMay increase as part of metabolic adaptationAnti-oxidant enzyme correlation
Autophagy statusAltered in autophagy mutantsComparative proteomics

These changes in expression likely reflect the shifting energy demands during Dictyostelium's life cycle, particularly the transition from unicellular to multicellular phases .

What are the optimal conditions for expressing recombinant Dictyostelium atp6?

Expressing recombinant Dictyostelium atp6 requires specialized conditions due to its hydrophobic nature and mitochondrial origin. Based on established protocols, the following methodological approach is recommended:

  • Expression System Selection:

    • Heterologous expression in E. coli often results in inclusion bodies due to the hydrophobic nature of atp6

    • Cell-free translation systems supplemented with lipids or detergents can improve solubility

    • Dictyostelium-based expression systems may provide the most authentic post-translational modifications

  • Vector Design:

    • Include a cleavable tag (His6 or GST) for purification

    • Consider fusion partners like MBP to enhance solubility

    • Codon optimization for the selected expression system

  • Expression Conditions:

    • Temperature: Lower temperatures (16-20°C) typically yield more properly folded protein

    • Induction: Gentle induction using lower concentrations of inducer

    • Media supplementation with specific lipids or membrane components

  • Purification Strategy:

    • Detergent screening (DDM, LMNG, or Fos-choline derivatives) to identify optimal solubilization

    • Affinity chromatography followed by size exclusion in the presence of appropriate detergent

    • Reconstitution into nanodiscs or liposomes for functional studies

The success of expression can be monitored using Western blotting with antibodies specific to atp6 or to the affinity tag, combined with mass spectrometry for identity confirmation .

What techniques are most effective for studying atp6 interactions with other ATP synthase subunits?

Multiple complementary techniques are required to comprehensively characterize atp6 interactions with other ATP synthase components:

  • Crosslinking Mass Spectrometry (XL-MS):

    • Utilizes chemical crosslinkers to capture transient interactions

    • MS/MS analysis identifies crosslinked peptides revealing interaction interfaces

    • Data analysis requires specialized software to identify crosslinked peptides

  • Cryo-Electron Microscopy:

    • Provides structural information at near-atomic resolution

    • Can visualize the hexameric arrangement of ATP synthase and the position of atp6

    • Sample preparation typically involves purification in detergent followed by vitrification

  • Co-immunoprecipitation Studies:

    • Pull-down assays using antibodies against atp6 or potential interaction partners

    • Western blotting to detect associated proteins

    • Can be performed under different conditions to assess interaction stability

  • Blue Native PAGE:

    • Allows separation of intact membrane protein complexes

    • Western blotting with subunit-specific antibodies can reveal association patterns

    • Can detect assembly intermediates containing atp6

  • FRET-based Approaches:

    • Fusion of fluorescent proteins to atp6 and potential interaction partners

    • Live-cell imaging to monitor interactions in real-time

    • Requires careful control experiments to validate genuine interactions

The combination of these techniques provides both static structural information and dynamic interaction data, offering a comprehensive view of atp6's role in ATP synthase assembly .

How does atp6 incorporation into ATP synthase affect mitochondrial membrane potential?

The incorporation of atp6 into ATP synthase represents a critical regulatory step that directly impacts mitochondrial membrane potential. Research has demonstrated that:

  • Premature association of atp6 with the Atp9p ring can create an unregulated proton leak, potentially dissipating the mitochondrial membrane potential .

  • The properly assembled atp6-containing complex provides the essential proton pathway that couples proton movement to ATP synthesis.

  • The timing of atp6 incorporation is tightly regulated, occurring only after structural elements necessary for coupling proton transfer to ATP synthesis are in place .

Experimental measurement of these effects typically involves:

  • Membrane potential-sensitive fluorescent dyes (TMRM, JC-1)

  • Oxygen consumption measurements to assess coupling efficiency

  • ATP synthesis assays under different membrane potential conditions

These measurements should be performed comparing wild-type cells with those expressing mutant forms of atp6 or with altered atp6 assembly to quantify the precise impact on membrane potential regulation .

What is the relationship between ATP synthase assembly and autophagy in Dictyostelium?

Proteomic analyses of Dictyostelium autophagy mutants have revealed a complex relationship between autophagy and ATP synthase assembly. Research findings indicate:

  • In ATG9 (autophagy-related protein 9) deficient cells, subunit 9 of ATP synthase shows altered expression, suggesting interconnected regulation .

  • The double knockout strain (ATG9−/16−) shows upregulation of multiple components of oxidative phosphorylation, including ATP synthase subunit 9, suggesting compensatory metabolic adaptation .

  • This upregulation correlates with changes in lipid metabolism and potentially increased ATP production, which may explain the less severe growth defect in these mutants compared to single ATG16− cells .

A proposed mechanism involves:

  • Autophagy deficiency leading to altered mitochondrial turnover

  • Accumulation of dysfunctional mitochondria triggering compensatory responses

  • Upregulation of specific ATP synthase components to maintain energy homeostasis

These findings highlight the interconnection between quality control pathways and energy metabolism, suggesting that proper ATP synthase assembly depends on functional autophagy for optimal mitochondrial homeostasis .

How can site-directed mutagenesis of atp6 provide insights into proton translocation mechanisms?

Site-directed mutagenesis of atp6 represents a powerful approach to investigate the molecular details of proton translocation in ATP synthase. A comprehensive mutagenesis strategy should include:

  • Target Selection Based on Conserved Residues:

    • Highly conserved residues across species (particularly Arg210, Glu219, His245 - numbering may differ in Dictyostelium)

    • Residues predicted to line the proton channel based on structural models

    • Residues at the interface with the c-ring (Atp9p)

  • Types of Mutations to Consider:

    • Conservative substitutions (maintaining charge/size)

    • Charge reversals to disrupt salt bridges

    • Hydrophobicity alterations to affect proton accessibility

    • Introduction of photo-crosslinkable amino acids to capture transient states

  • Functional Assays for Mutant Characterization:

    Assay TypeMeasurementExpected Outcome for Critical Residues
    ATP synthesisRate measurementDecreased activity
    Proton pumpingFluorescence-basedAltered kinetics or complete loss
    ATP hydrolysisEnzymatic couplingMay show uncoupling from proton movement
    Membrane potentialPotentiometric dyesPotential leak or altered gradient formation
    Thermal stabilityDifferential scanning calorimetryAltered stability of the F0 complex
  • Structural Validation:

    • Cryo-EM of mutant complexes to visualize structural consequences

    • Molecular dynamics simulations to predict water/proton movements through altered channels

By systematically analyzing the effects of these mutations, researchers can map the proton translocation pathway and identify key residues involved in the energy conversion process that drives ATP synthesis .

What approaches can be used to study the evolution of atp6 across Amoebozoa species?

Understanding the evolution of atp6 across Amoebozoa requires a multi-faceted approach combining sequence analysis, structural biology, and functional studies:

  • Comprehensive Sequence Analysis:

    • Multiple sequence alignment of atp6 from diverse Amoebozoa

    • Calculation of conservation scores for each position

    • Identification of taxonomically restricted residues

    • Analysis of selection pressure (dN/dS ratios) to identify positions under positive or purifying selection

  • Structural Comparative Analysis:

    • Homology modeling of atp6 from different species

    • Mapping of variable and conserved regions onto 3D structures

    • Comparison of predicted interaction interfaces with other ATP synthase subunits

    • AlphaFold 3 or similar tools can be used to predict structures when experimental data is lacking

  • Horizontal Gene Transfer Assessment:

    • Phylogenetic analyses to identify potential horizontal gene transfer events

    • Comparison with bacterial atp6 homologs to identify evolutionary relationships

    • Analysis of codon usage bias as an indicator of gene transfer

  • Functional Conservation Testing:

    • Heterologous expression of atp6 from different species in Dictyostelium

    • Complementation assays to test functional conservation

    • Hybrid ATP synthase construction to identify species-specific interactions

  • Correlation with Ecological Adaptations:

    • Analysis of atp6 sequence features in relation to environmental niches

    • Identification of adaptations related to temperature, pH, or energy availability

    • Comparison of mutation rates between free-living and symbiotic Amoebozoa

This combined approach would provide insights into how ATP synthase has evolved within Amoebozoa and adapted to various ecological niches while maintaining its essential function in energy conversion .

What is known about post-translational modifications of atp6 in Dictyostelium and their functional significance?

Post-translational modifications (PTMs) of atp6 in Dictyostelium remain an under-explored area with significant implications for ATP synthase regulation and function. Current research suggests:

  • Types of PTMs Identified:

    • Phosphorylation sites have been detected in proteomic studies

    • Acetylation may occur at specific lysine residues

    • Oxidative modifications can occur especially under stress conditions

  • Techniques for PTM Identification:

    • Enrichment strategies (TiO2 for phosphopeptides, anti-acetyl lysine antibodies)

    • High-resolution mass spectrometry

    • Site-specific antibodies for Western blot validation

    • Targeted multiple reaction monitoring (MRM) for quantification

  • Functional Implications:

    Modification TypeSuspected LocationProposed FunctionDetection Method
    PhosphorylationN-terminal domainAssembly regulationMS/MS with phospho-enrichment
    AcetylationConserved lysinesActivity modulationAcetylome analysis
    Oxidative modificationReactive thiolsStress responseRedox proteomics
  • Developmental Regulation:

    • PTM patterns likely change during Dictyostelium development

    • Different PTMs may predominate during growth versus differentiation

    • Autophagy deficiency affects oxidative stress, potentially altering oxidative PTMs

  • Experimental Approaches:

    • Site-directed mutagenesis of modified residues to non-modifiable variants

    • In vitro reconstitution with modified and unmodified atp6

    • Quantitative proteomics comparing PTM status across conditions

This research area represents a frontier in understanding the fine-tuning of ATP synthase function in response to cellular conditions and developmental signals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.