Recombinant Dictyostelium discoideum Bax inhibitor 1 homolog (DDB_G0287617)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cell Death Regulation

DDB_G0287617 is a homolog of human Bax inhibitor-1 (BI-1), a conserved suppressor of apoptosis. Key mechanisms include:

  • BAX Inhibition: Modulates BAX activation by preventing conformational changes required for mitochondrial pore formation .

  • ER Stress Response: Interacts with ER stress sensors (e.g., IreA) to regulate unfolded protein response (UPR) pathways .

  • Calcium Homeostasis: Influences intracellular Ca²⁺ flux, which is critical for apoptosis and autophagy regulation .

3.1. Disease Modeling

D. discoideum is used to study neurodegenerative diseases (e.g., Parkinson’s, Alzheimer’s) due to conserved pathways. DDB_G0287617’s role in ER stress and apoptosis provides insights into:

  • γ-Secretase Function: Presenilin homologs in D. discoideum show functional overlap with human proteins implicated in Alzheimer’s .

  • Mitochondrial Dysregulation: Linked to DJ-1 and AMPK pathways, relevant to Parkinson’s disease .

3.2. Drug Development

  • Covalent BAX Inhibitors: Small molecules like CBI1 (Covalent BAX Inhibitor 1) mimic DDB_G0287617’s inhibitory effects, offering therapeutic potential for diseases involving excessive apoptosis .

  • ER Stress Modulators: Screens using this protein identify compounds targeting UPR pathways .

4.1. Functional Conservation

Human ProteinD. discoideum HomologObserved ConservationCitation
BAXDDB_G0287617Structural and functional homology in apoptosis
LRRK2 (Parkinson’s)Roco4Kinase activity regulation
PresenilinPsenBγ-Secretase-independent developmental roles

4.2. Mechanistic Insights

  • Autophagy Link: ER stress in D. discoideum activates autophagy, with DDB_G0287617 required for late-stage autophagosome formation .

  • Dual Inhibition: Competes with mitochondrial lipids for BAX binding, blocking both BAX activation and lipid-mediated stimulation .

Future Directions

  • Therapeutic Targeting: Develop covalent inhibitors mimicking DDB_G0287617’s BAX suppression for neuroprotection or chemotherapy adjuvants .

  • ER Stress Pathways: Elucidate cross-talk between BI-1 homologs and UPR components in metazoans .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0287617; Bax inhibitor 1 homolog; BI-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0287617
Target Protein Sequence
MASTSNRNFFSSNMTQIPMDEKIRIALQFNNLSQSTKQTLTKVYCALAIGILTATVGVLF SMFIYRPGFLMTLLLVIGSAILFATTPRTQDYKTQVKRFTLFNLVTFVTGMSSSGLIELY MDINSSIVLNAFMATCGIFISFTLFSLLTNKRLYIFIGSSLASLSIGIFVLALTRLFGGY SEPLDQLFILAILASSVLFIIFDTQIMVHRIENLGEKDVLFHAFILFYDFVDLFRVILKI LAKKENKNNNKSRR
Uniprot No.

Target Background

Database Links
Protein Families
BI1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum Bax inhibitor 1 homolog (DDB_G0287617)?

Dictyostelium discoideum Bax inhibitor 1 homolog (DDB_G0287617) is an evolutionarily conserved endoplasmic reticulum (ER)-resident protein that functions as a cell death suppressor. This protein belongs to the BI-1 family, which is found across eukaryotes from plants to animals. The full-length protein consists of 254 amino acids and shares significant sequence and functional conservation with BI-1 proteins from other organisms. When produced recombinantly, it can be expressed with tags such as His-tag to facilitate purification and detection in experimental systems . As an ER-resident protein, it plays crucial roles in regulating cell death pathways, particularly in response to various stresses, similar to its homologs in other species where it inhibits Bax-induced cell death .

How does DDB_G0287617 compare to BI-1 proteins in other organisms?

The BI-1 family represents a highly conserved group of proteins across eukaryotes, with DDB_G0287617 sharing significant structural and functional similarities with its counterparts in other organisms. Despite fundamental differences between different cell types across kingdoms, these cell death regulators maintain conserved functions. The Dictyostelium homolog preserves key features such as:

  • ER membrane localization, similar to wheat TaBI-1.1 and other BI-1 proteins

  • Cell death suppressive activities

  • Predicted transmembrane domains characteristic of the BI-1 family

  • Response to stress stimuli that would normally trigger cell death pathways

Studies in wheat have shown that BI-1 (TaBI-1.1) is involved in biotic stress responses, and its expression is regulated by salicylic acid (SA) and abscisic acid (ABA) . When expressed in Arabidopsis, TaBI-1.1 enhances resistance to pathogen infection and modulates SA-related gene expression . These findings suggest that the DDB_G0287617 homolog might play similar roles in stress responses in Dictyostelium, providing a unique model system to study conserved cell death mechanisms in a simple eukaryote that exhibits both unicellular and multicellular life stages .

What are the optimal conditions for expressing recombinant DDB_G0287617 protein?

For optimal expression of recombinant DDB_G0287617, researchers typically employ E. coli expression systems, which have been successfully used to produce the full-length protein (amino acids 1-254) with His-tag . The methodology involves:

  • Vector selection: Using a prokaryotic expression vector like pCOLD (similar to what was used for TaBI-1.1 expression)

  • Expression strain: BL21(DE3) or Rosetta strains are recommended for membrane proteins

  • Induction conditions:

    • Temperature: 16-18°C for overnight expression following induction

    • IPTG concentration: 0.1-0.5 mM

    • OD600 at induction: 0.6-0.8

  • Buffer optimization: Including mild detergents (0.1-1% Triton X-100 or n-Dodecyl β-D-maltoside) to solubilize the membrane protein

  • Reducing agents: Addition of DTT or β-mercaptoethanol (1-5 mM) to prevent oxidation of cysteine residues

It's important to note that as an ER-resident protein, DDB_G0287617 likely contains transmembrane domains that may pose challenges for soluble expression. Strategies to enhance solubility may include fusion to solubility-enhancing tags such as SUMO or MBP, in addition to the His-tag used for purification .

What purification strategies are most effective for isolating DDB_G0287617 with high purity?

Purification of DDB_G0287617 requires a multi-step approach to achieve high purity while maintaining the protein's native conformation and activity:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for His-tagged protein

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% appropriate detergent

    • Washing: Stepwise imidazole gradient (10 mM, 20 mM, 40 mM)

    • Elution: 250-300 mM imidazole

  • Intermediate purification: Ion exchange chromatography

    • Anion exchange (Q Sepharose) at pH 8.0 to separate charged contaminants

  • Polishing step: Size exclusion chromatography

    • Superdex 200 column in a buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and 0.03% appropriate detergent

  • Quality control: SDS-PAGE, Western blot, and mass spectrometry to confirm identity and purity

    • Expected molecular weight: ~28 kDa plus tag contribution

  • Concentration determination: Bradford or BCA assay with BSA standard curve, considering potential interference from detergents

Throughout purification, maintaining a mild detergent concentration is crucial for preventing aggregation while preserving the native structure of this membrane protein. For functional studies, reconstitution into liposomes or nanodiscs may be necessary to provide a lipid environment similar to the ER membrane .

How can the cell death suppression activity of DDB_G0287617 be measured experimentally?

Measuring the cell death suppression activity of DDB_G0287617 requires a multi-faceted approach that can be implemented in both heterologous systems and in Dictyostelium:

  • Heterologous expression systems:

    • Yeast complementation assay: Express DDB_G0287617 in yeast BI-1 deletion mutants and measure survival under stress conditions (H₂O₂, heat shock, ER stress inducers like tunicamycin)

    • Mammalian cell culture: Transfect cells with DDB_G0287617 and Bax expression constructs, then quantify apoptosis by Annexin V/PI staining and flow cytometry

  • Dictyostelium-specific approaches:

    • Generate knockout mutants using homologous recombination with a resistance cassette (similar to the approach used for TCTP gene disruption in Dictyostelium)

    • Create overexpression strains using Dictyostelium expression vectors

    • Subject cells to stressors known to induce cell death (H₂O₂, heat shock, heavy metals, starvation)

  • Cell death quantification methods:

    • Propidium iodide exclusion assay to measure membrane integrity

    • MTT or similar viability assays to assess metabolic activity

    • Caspase-like activity measurement using fluorogenic substrates

    • Analysis of DNA fragmentation via TUNEL assay

    • Measurement of mitochondrial membrane potential using JC-1 dye

  • Developmental phenotype analysis:

    • Monitor development on non-nutrient agar at a density of 5 × 10⁷ cells/mL as described for TCTP studies

    • Document timing and pattern of developmental structures using stereomicroscopy

    • Quantify differences in timing, morphology, and proportion of cells undergoing differentiation

The combination of these approaches provides comprehensive insights into how DDB_G0287617 regulates cell death pathways, both in normal development and under stress conditions .

What stress conditions are most effective for studying DDB_G0287617 function in Dictyostelium?

To effectively study DDB_G0287617 function in Dictyostelium, several stress conditions can be employed that are likely to engage BI-1-dependent pathways:

  • ER stress inducers:

    • Tunicamycin (0.5-2 μg/mL): Inhibits N-linked glycosylation

    • Thapsigargin (0.1-1 μM): Disrupts calcium homeostasis by inhibiting ER Ca²⁺-ATPase

    • DTT (1-5 mM): Reduces disulfide bonds

    • Brefeldin A (1-10 μg/mL): Disrupts ER-Golgi transport

  • Oxidative stress:

    • Hydrogen peroxide (0.1-1 mM)

    • Menadione (50-200 μM): Generates superoxide radicals

    • Paraquat (0.1-1 mM): Produces reactive oxygen species

  • Developmental stress:

    • Starvation-induced development (as used in TCTP studies)

    • Temperature stress (4°C for synchronization, followed by 22°C for development)

    • pH stress (pH 5.0-5.5 vs. standard pH 6.5)

  • Chemical-induced cell death:

    • Staurosporine (0.1-10 μM): Protein kinase inhibitor that induces apoptosis

    • Cadmium chloride (50-500 μM): Heavy metal stress

For experimental design, wild-type, knockout, and overexpression strains should be cultured to log phase (1-3 × 10⁶ cells/mL) in axenic medium, then exposed to the selected stress condition. Cell survival can be monitored over time (0-48 hours) using viability assays, and developmental phenotypes can be assessed by plating stressed cells on non-nutrient agar at 5 × 10⁷ cells/mL and photographing under a stereomicroscope at regular intervals .

What methods are most appropriate for identifying protein-protein interactions of DDB_G0287617?

Identifying protein-protein interactions of DDB_G0287617 requires specialized approaches for membrane proteins that maintain their native conformation during analysis:

  • Yeast two-hybrid system with membrane protein adaptations:

    • Split-ubiquitin yeast two-hybrid specifically designed for membrane proteins

    • MATCHMAKER two-hybrid system (as used for TaBI-1.1 interactions)

    • Construct design: Clone DDB_G0287617 into vectors like pGBKT7 (bait) and pGADT7 (prey)

    • Transformation into yeast strain AH109 and selection on appropriate dropout medium

    • Confirmation on high-stringency selection medium (SD/-Trp-Leu-His-Ade)

  • In vitro pull-down assays:

    • Express DDB_G0287617 with affinity tags (His, GST) using prokaryotic expression vectors like pCOLD or pGEX-4T-1

    • Perform GST pull-down assays with candidate interactors or cell lysates

    • Detect interactions via western blotting with specific antibodies

  • Co-immunoprecipitation from Dictyostelium cells:

    • Generate Dictyostelium strains expressing tagged versions of DDB_G0287617

    • Prepare cell lysates with membrane-solubilizing detergents

    • Precipitate protein complexes with antibodies against the tag

    • Identify interacting partners by mass spectrometry

  • Proximity-based labeling methods:

    • BioID or TurboID fusion constructs expressed in Dictyostelium

    • Biotinylation of proximal proteins followed by streptavidin pull-down

    • Mass spectrometry identification of captured proteins

  • Fluorescence-based interaction assays:

    • Bimolecular Fluorescence Complementation (BiFC) in Dictyostelium or mammalian cells

    • Förster Resonance Energy Transfer (FRET) with fluorescently tagged proteins

    • Co-localization studies using confocal microscopy with fluorescent protein fusions

The combination of multiple complementary approaches provides robust validation of interactions, which is particularly important for membrane proteins like DDB_G0287617 .

How does DDB_G0287617 interact with other components of the cell death machinery in Dictyostelium?

Based on studies of BI-1 homologs in other organisms, DDB_G0287617 likely interacts with multiple components of the cell death machinery in Dictyostelium through specific protein-protein interactions:

  • Potential interactions with calcium regulators:

    • BI-1 proteins typically regulate calcium homeostasis at the ER

    • Look for interactions with calcium channels, pumps (SERCA homologs), and calcium-binding proteins

    • Test interactions using co-immunoprecipitation with specific antibodies against calcium regulatory proteins

  • ER stress signaling components:

    • Examine interactions with Dictyostelium homologs of IRE1, PERK, and ATF6

    • Investigate through both physical interaction assays and genetic epistasis analysis

    • Measure UPR (unfolded protein response) activation using reporter constructs

  • Potential aquaporin interactions:

    • Based on the interaction between wheat TaBI-1.1 and TaPIP1

    • Identify Dictyostelium PIPs and test direct interactions

    • Verify co-localization at the ER membrane using fluorescent protein fusions

    • Assess functional significance through co-expression and phenotypic analysis

  • Mitochondrial pathway components:

    • Investigate interactions with Dictyostelium homologs of BCL-2 family proteins

    • Examine whether DDB_G0287617 affects mitochondrial membrane permeabilization

    • Test using subcellular fractionation and cytochrome c release assays

  • Experimental workflow for comprehensive analysis:

    • Initial screening using membrane-adapted yeast two-hybrid or BioID

    • Confirmation of direct interactions using in vitro pull-down assays

    • Validation in Dictyostelium cells using co-immunoprecipitation

    • Functional significance assessment through genetic manipulation and stress response assays

This multi-layered approach will provide insights into how DDB_G0287617 is integrated into the Dictyostelium cell death regulatory network, highlighting both conserved and unique aspects compared to other model organisms .

What is the expression pattern of DDB_G0287617 during Dictyostelium development?

The expression pattern of DDB_G0287617 during Dictyostelium development can be analyzed using approaches similar to those employed for TCTP gene expression studies:

  • Temporal expression analysis:

    • Semi-quantitative RT-PCR or quantitative real-time PCR to measure mRNA levels throughout development

    • RNA extraction from cells at different developmental time points (0, 2, 4, 6, 8, 12, 16, 20, and 24 hours)

    • Based on similar studies with TCTP, DDB_G0287617 might show stage-specific expression changes during the transition from unicellular to multicellular phases

  • Spatial expression patterns:

    • In situ hybridization to localize mRNA in developing structures

    • Reporter gene constructs (e.g., promoter::GFP) to visualize expression in live cells during development

    • Single-cell RNA sequencing to identify cell-type specific expression

  • Promoter analysis:

    • Bioinformatic identification of regulatory elements in the DDB_G0287617 promoter

    • Promoter deletion analysis to identify key regulatory regions

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the promoter

  • Experimental protocol outline:

    • Grow Dictyostelium cells axenically to log phase

    • Harvest cells and develop at a density of 5 × 10⁷ cells/mL on non-nutrient agar

    • Synchronize development by incubation at 4°C for 4-6 hours followed by 22°C

    • Collect samples at specific time points during development

    • Extract RNA using TRIzol or similar method

    • Perform RT-PCR using DDB_G0287617-specific primers

    • Analyze expression relative to housekeeping genes like actin

By analyzing expression patterns throughout development, researchers can gain insights into the biological processes that may involve DDB_G0287617, particularly during transitions between different developmental stages where programmed cell death plays critical roles .

How is DDB_G0287617 expression regulated in response to different stressors?

The regulation of DDB_G0287617 expression in response to various stressors likely involves complex signaling pathways and transcriptional regulation. Based on knowledge of BI-1 regulation in other organisms, the following experimental approaches can be employed:

  • Stress treatment experimental design:

    • Grow Dictyostelium cells to mid-log phase (1-3 × 10⁶ cells/mL)

    • Expose cells to different stressors:

      • ER stress inducers (tunicamycin, thapsigargin, DTT)

      • Oxidative stress (H₂O₂, menadione)

      • Heavy metals (cadmium, copper)

      • Heat shock (30-37°C)

      • Osmotic stress (sorbitol, NaCl)

    • Collect samples at multiple time points (0, 0.5, 1, 2, 4, 8, 12, and 24 hours)

    • Extract RNA and perform RT-qPCR with DDB_G0287617-specific primers

    • Calculate fold changes relative to untreated controls and time zero

  • Hormone and signaling molecule responses:

    • Based on wheat BI-1 studies, test effects of molecules like:

      • cAMP (crucial in Dictyostelium signaling)

      • DIF-1 (Differentiation Inducing Factor)

      • Salicylic acid (shown to induce TaBI-1.1 in wheat)

      • Abscisic acid (shown to down-regulate TaBI-1.1 in wheat)

  • Transcription factor identification:

    • Bioinformatic analysis of DDB_G0287617 promoter for transcription factor binding sites

    • ChIP assays following stress treatment to identify bound transcription factors

    • Reporter gene assays with wild-type and mutated promoter constructs

  • Post-transcriptional regulation:

    • Analysis of mRNA stability following stress using actinomycin D treatment

    • Assessment of potential microRNA regulation

    • Polysome profiling to evaluate translational efficiency

This comprehensive analysis of DDB_G0287617 regulation will provide insights into how Dictyostelium responds to different stressors and how this evolutionarily conserved cell death regulator is integrated into stress response pathways .

How can CRISPR-Cas9 be optimized for generating DDB_G0287617 knockout and knock-in Dictyostelium strains?

Optimizing CRISPR-Cas9 for genetic manipulation of DDB_G0287617 in Dictyostelium requires specialized approaches considering both the organism's unique genomic features and the target gene characteristics:

  • Guide RNA (gRNA) design:

    • Target exonic regions preferably in the first half of the coding sequence

    • Select 20-nucleotide target sequences with NGG PAM sites

    • Evaluate off-target potential using Dictyostelium genome database

    • Design multiple gRNAs (3-4) targeting different regions to increase success rate

    • Recommended tools: E-CRISP or CRISPOR with Dictyostelium genome integration

  • Dictyostelium-optimized CRISPR-Cas9 delivery system:

    • Use expression vectors with Dictyostelium-specific promoters (actin 15 promoter)

    • Consider codon-optimized Cas9 for Dictyostelium

    • Either all-in-one vector or separate Cas9 and gRNA vectors

    • Include selectable markers appropriate for Dictyostelium (G418, blasticidin, hygromycin)

  • Homology-directed repair (HDR) template design:

    • For knockouts: Include ~800-1000 bp homology arms flanking the disruption cassette

    • For knock-ins: Design HDR template with the desired modification (tag, mutation)

    • Use blasticidin resistance cassette (BSR) as in TCTP knockout studies

    • Consider using the hygromycin resistance marker for additional selection options

  • Transformation protocol optimization:

    • Electroporation parameters: 0.85 kV/cm, 2 pulses, 5 ms pulse length

    • Cell density: 1-2 × 10⁷ cells/mL for transformation

    • Recovery: Allow 24 hours recovery in axenic medium before selection

    • Selection: Apply appropriate antibiotic at optimized concentration (e.g., 10 μg/mL blasticidin)

  • Verification strategies:

    • PCR screening for positive integration using primers spanning integration sites

    • Confirmation by sequencing of the modified locus

    • RT-PCR to verify absence of transcript in knockout strains

    • Western blotting to confirm protein absence or modification

  • Potential challenges and solutions:

    • High A/T content in Dictyostelium genome: Design primers and homology arms carefully

    • Multiple copies of target gene: Verify copy number before CRISPR targeting

    • Off-target effects: Perform whole genome sequencing of selected clones

    • Phenotypic validation: Compare with traditional knockout methods

This optimized CRISPR-Cas9 approach will facilitate efficient generation of DDB_G0287617 knockout and knock-in strains, enabling detailed functional studies of this important cell death regulator in Dictyostelium .

What high-throughput approaches can be used to identify the global impact of DDB_G0287617 on Dictyostelium cellular pathways?

Several high-throughput approaches can be employed to comprehensively characterize the global impact of DDB_G0287617 on Dictyostelium cellular pathways:

  • Transcriptomic analysis:

    • RNA-sequencing comparing wild-type, knockout, and overexpression strains

    • Temporal analysis during development and under various stress conditions

    • Single-cell RNA-seq to capture cell-type specific effects during development

    • Differential expression analysis using DESeq2 or similar tools

    • Gene Ontology and pathway enrichment analysis to identify affected biological processes

  • Proteomics approaches:

    • Quantitative proteomics (TMT or SILAC) to identify protein abundance changes

    • Phosphoproteomics to identify altered signaling pathways

    • Protein interaction network mapping using IP-MS or BioID approaches

    • Membrane protein enrichment strategies to capture ER-specific changes

    • Analysis of detergent-resistant membrane fractions to identify lipid raft alterations

  • Metabolomics and lipidomics:

    • Targeted and untargeted metabolomics to identify metabolic alterations

    • Lipidomics focusing on ER membrane composition changes

    • Calcium flux measurements using fluorescent indicators

    • Analysis of ROS production and oxidative stress markers

  • Functional genomics screens:

    • CRISPR interference/activation screens to identify genetic interactions

    • Chemical genomics to identify compound sensitivity profiles

    • Synthetic lethality screens to discover pathway redundancies

  • Cellular phenotyping:

    • High-content imaging with fluorescent markers for organelle morphology

    • Flow cytometry for cell death markers and ROS detection

    • Live cell imaging of development with automated image analysis

    • Microfluidic single-cell analysis of stress responses

  • Integrative analysis workflow:

    • Multi-omics data integration using computational approaches

    • Network analysis to identify key regulatory hubs

    • Comparison with BI-1 studies in other organisms to identify conserved mechanisms

    • Validation of key findings using targeted genetic and biochemical approaches

This multi-faceted approach will provide a comprehensive understanding of DDB_G0287617's role in Dictyostelium cellular pathways, revealing both conserved BI-1 functions and potentially novel roles specific to Dictyostelium biology .

What advantages does Dictyostelium offer as a model system for studying Bax inhibitor 1 function?

Dictyostelium discoideum provides several unique advantages as a model system for studying Bax inhibitor 1 function that complement other established models:

  • Evolutionary significance:

    • Dictyostelium represents an evolutionary position between unicellular organisms and metazoans

    • Allows study of conserved cell death mechanisms in a simplified system

    • Provides insights into the ancestral functions of BI-1 proteins

    • Enables identification of core BI-1 functions versus species-specific adaptations

  • Experimental tractability:

    • Haploid genome simplifies genetic manipulation (single gene knockout produces phenotype)

    • Established transformation methods and selection markers

    • Relatively rapid growth (doubling time of 8-12 hours)

    • Simple axenic laboratory cultivation

    • Amenable to high-throughput approaches and genetic screens

  • Unique developmental program:

    • Transitions between unicellular and multicellular stages

    • Programmed cell death occurs naturally during development

    • Allows study of BI-1 role in both single-cell survival and multicellular development

    • Synchronized development can be induced and monitored easily

    • Distinct cell types emerge during development, enabling cell-type specific analyses

  • Cellular processes:

    • Contains basic components of apoptotic machinery found in higher eukaryotes

    • ER stress responses are conserved but less complex than in mammalian systems

    • Phagocytosis and autophagy pathways well-developed and easily studied

    • Calcium signaling pathways with similarities to higher eukaryotes

  • Practical advantages for BI-1 research:

    • Less genetic redundancy compared to mammalian systems

    • ER stress can be easily induced and monitored

    • Development can be synchronized at 4°C and then continued at 22°C

    • Visualizing developmental phenotypes requires only a stereomicroscope

    • Cell death can be quantified using simple assays

These advantages make Dictyostelium a valuable complementary model system for studying the fundamental functions of Bax inhibitor 1, potentially revealing conserved mechanisms of cell death regulation that have been maintained throughout eukaryotic evolution .

How can developmental phenotypes of DDB_G0287617 mutants be effectively analyzed?

Effective analysis of developmental phenotypes in DDB_G0287617 mutants requires a systematic approach that captures both macroscopic and microscopic changes throughout Dictyostelium's developmental cycle:

  • Standard developmental assay protocol:

    • Grow cells axenically to mid-log phase (1-3 × 10⁶ cells/mL)

    • Harvest and wash cells in development buffer (DB: 5 mM Na₂HPO₄, 5 mM KH₂PO₄, 1 mM CaCl₂, 2 mM MgCl₂, pH 6.5)

    • Plate at a density of 5 × 10⁷ cells/mL on non-nutrient agar

    • Synchronize development by incubation at 4°C for 4-6 hours

    • Transfer to 22°C to initiate development

    • Document development at regular intervals (0, 4, 8, 12, 16, 20, 24 hours) using a stereomicroscope

  • Quantitative phenotypic parameters:

    • Timing of developmental stages (aggregation, mound formation, tipped aggregate, slug, culmination)

    • Morphometric analysis of structures (size, shape, proportions)

    • Cell type proportioning (prespore:prestalk ratio)

    • Spore viability and germination efficiency

    • Chemotactic efficiency during aggregation

  • Advanced imaging approaches:

    • Time-lapse microscopy to capture dynamic processes

    • Confocal microscopy with cell-type specific markers

    • Cell tracking to analyze individual cell behaviors

    • Fluorescent reporters for cell death (Annexin V, propidium iodide)

    • Calcium imaging using genetically encoded calcium indicators

  • Molecular phenotyping:

    • Cell-type specific gene expression using RT-qPCR

    • In situ hybridization for spatial expression patterns

    • Protein localization using immunofluorescence or fluorescent protein fusions

    • Western blotting for developmental markers

  • Stress response during development:

    • Challenge developing structures with stressors (oxidative, ER stress)

    • Monitor development under varying environmental conditions (temperature, pH, osmotic stress)

    • Analyze cell death patterns during normal and stressed development

    • Test resistance to starvation and other nutrient limitations

  • Data analysis and presentation:

    • Quantify developmental timing using Kaplan-Meier analysis

    • Present morphological data with size distributions and statistical analysis

    • Use principal component analysis for multivariate phenotypic data

    • Create developmental phenotype profiles for comparative analysis

This comprehensive approach will reveal how DDB_G0287617 affects Dictyostelium development at cellular, molecular, and structural levels, providing insights into the role of this BI-1 homolog in coordinating cell survival and death during the transition from unicellular to multicellular stages .

How does DDB_G0287617 function compare to BI-1 proteins across different evolutionary lineages?

The evolutionary conservation and functional divergence of BI-1 proteins across different lineages provides a fascinating context for understanding DDB_G0287617:

  • Structural conservation analysis:

    • Sequence alignment of DDB_G0287617 with BI-1 proteins from diverse organisms (yeast, plants, insects, mammals)

    • Identification of conserved transmembrane domains and functional motifs

    • Protein structural modeling to predict three-dimensional conservation

    • Analysis of conserved interaction interfaces and regulatory sites

  • Functional conservation assessment:

    • Cross-species complementation experiments:

      • Expression of DDB_G0287617 in yeast, plant, or mammalian BI-1 mutants

      • Testing whether DDB_G0287617 can rescue phenotypes in other species

      • Quantifying the degree of functional rescue under different stress conditions

    • Conserved interactions with cellular machinery:

      • Comparison of protein interaction networks across species

      • Analysis of conservation in subcellular localization (primarily ER membrane)

      • Assessment of calcium regulatory functions across lineages

  • Lineage-specific adaptations:

    • Plants: Enhanced role in response to biotic stresses and pathogen responses

      • Similar to TaBI-1.1's role in enhancing resistance to pathogen infection

      • Interaction with aquaporins (like TaPIP1) potentially conserved in Dictyostelium

    • Mammals: More complex integration with Bcl-2 family proteins and apoptotic machinery

    • Yeast: Focus on ER stress response and calcium regulation

    • Dictyostelium: Potential unique roles in development and starvation response

  • Evolutionary rate analysis:

    • Calculation of evolutionary rates (dN/dS ratios) across different domains of the protein

    • Identification of regions under purifying selection (highly conserved) versus adaptive selection

    • Correlation of evolutionary conservation with functional importance

  • Experimental approaches for comparative analysis:

    • Domain swapping experiments between DDB_G0287617 and other BI-1 proteins

    • Creation of chimeric proteins to identify functionally important regions

    • Heterologous expression systems to test function across different cellular backgrounds

    • Comparative stress response profiling across different model organisms

This evolutionary perspective on DDB_G0287617 will provide insights into both the ancestral functions of BI-1 proteins that have been maintained across eukaryotes and the specialized adaptations that have evolved in different lineages .

What are common challenges in purifying and working with recombinant DDB_G0287617 and how can they be addressed?

Working with recombinant DDB_G0287617, an ER membrane protein, presents several technical challenges that require specific troubleshooting approaches:

  • Expression level optimization:
    Challenge: Low expression levels in bacterial systems
    Solutions:

    • Test multiple bacterial strains (BL21, Rosetta, C41/C43 for membrane proteins)

    • Optimize codon usage for E. coli

    • Try lower induction temperatures (16-18°C) and IPTG concentrations (0.1-0.5 mM)

    • Consider fusion partners that enhance expression (SUMO, MBP, TrxA)

    • Test auto-induction media to achieve gradual protein expression

  • Protein solubility issues:
    Challenge: Membrane proteins often form inclusion bodies
    Solutions:

    • Screen detergents systematically (DDM, LDAO, Triton X-100, CHAPS)

    • Test mild solubilization conditions (lower temperature, gentle mixing)

    • Consider native membrane mimetics (nanodiscs, amphipols, SMALPs)

    • If using inclusion bodies, develop optimal refolding protocols

    • Try fusion to solubility-enhancing tags (GST, MBP)

  • Purification challenges:
    Challenge: Co-purification of contaminants, aggregation during concentration
    Solutions:

    • Optimize imidazole concentration in washing steps to reduce non-specific binding

    • Include adenosine triphosphate (ATP) and MgCl₂ in lysis buffer to remove chaperones

    • Add low concentrations of glycerol (5-10%) to stabilize the protein

    • Use size exclusion as a final polishing step to remove aggregates

    • Consider on-column refolding for better recovery

  • Protein stability issues:
    Challenge: Aggregation and precipitation during storage
    Solutions:

    • Screen buffer conditions systematically (pH, salt, additives)

    • Add stabilizing agents (glycerol, sucrose, specific lipids)

    • Store at higher concentrations of mild detergents

    • Aliquot and flash-freeze, avoid repeated freeze-thaw cycles

    • Consider lyophilization with appropriate excipients

  • Activity assays and functional characterization:
    Challenge: Maintaining native conformation for functional studies
    Solutions:

    • Reconstitute into liposomes or nanodiscs for functional assays

    • Verify proper folding using circular dichroism

    • Use fluorescence-based assays to monitor conformational changes

    • Develop cell-based activity assays as alternatives to purified protein

These troubleshooting approaches will help overcome the technical challenges associated with producing and working with recombinant DDB_G0287617, ensuring that the protein samples used for functional and structural studies maintain their native properties .

How can inconsistent phenotypes in DDB_G0287617 mutant studies be reconciled and validated?

Inconsistent phenotypes in DDB_G0287617 mutant studies can arise from various sources and require systematic approaches for reconciliation and validation:

  • Genetic background verification:
    Challenge: Unintended genetic alterations beyond the target gene
    Solutions:

    • Sequence verify the entire DDB_G0287617 locus including flanking regions

    • Perform whole genome sequencing of mutant strains to identify off-target mutations

    • Generate multiple independent knockout lines using different methodologies

    • Create reversion lines by reintroducing wild-type DDB_G0287617 to confirm phenotype rescue

    • Use RNA-seq to confirm absence of alternative transcripts or truncated mRNAs

  • Methodological standardization:
    Challenge: Variations in experimental conditions between studies
    Solutions:

    • Standardize growth conditions (medium composition, cell density, growth phase)

    • Use precise cell densities for development (5 × 10⁷ cells/mL as standard)

    • Synchronize development consistently (4°C for 4-6 hours followed by 22°C)

    • Document exact buffer compositions and environmental parameters

    • Implement blinded analysis to prevent observer bias

  • Phenotypic analysis refinement:
    Challenge: Subjective or qualitative phenotype assessment
    Solutions:

    • Develop quantitative metrics for phenotype analysis

    • Use automated image analysis for objective morphological assessment

    • Implement time-lapse photography with consistent intervals

    • Quantify developmental timing with precise milestones

    • Use multiple phenotypic parameters rather than single endpoints

  • Strain maintenance issues:
    Challenge: Phenotypic drift or selection during laboratory maintenance
    Solutions:

    • Maintain frozen stocks from early passages

    • Limit the number of passages before returning to frozen stocks

    • Test for phenotypic consistency across different passages

    • Implement standardized revival protocols

    • Document passage number in all experiments

  • Conditional phenotypes:
    Challenge: Phenotypes that only appear under specific conditions
    Solutions:

    • Test multiple stress conditions systematically

    • Vary developmental conditions (temperature, buffer composition, humidity)

    • Challenge cells with different nutrient sources

    • Examine development on different substrates

    • Consider bacterial food source effects for non-axenic growth

  • Validation through complementary approaches:
    Challenge: Over-reliance on a single experimental approach
    Solutions:

    • Combine genetic approaches (knockout, knockdown, overexpression)

    • Use pharmacological inhibitors as complementary approaches

    • Implement rescue experiments with wild-type and mutated versions

    • Perform domain deletion analysis to identify functional regions

    • Use heterologous expression systems for cross-validation

By implementing these reconciliation and validation strategies, researchers can ensure that phenotypes attributed to DDB_G0287617 mutations are robust, reproducible, and truly reflective of the gene's biological function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.