Recombinant Dictyostelium discoideum Cln5-like protein 1 (cln5la)

Shipped with Ice Packs
In Stock

Description

Introduction

Ceroid lipofuscinosis neuronal protein 5 (CLN5) is a protein associated with neuronal ceroid lipofuscinosis (NCL), also known as Batten disease . Batten disease is a neurodegenerative lysosomal storage disease . Dictyostelium discoideum is a social amoeba used as a model organism to study the function of CLN5 due to the presence of a CLN5 homolog .

Function and Characteristics

Dictyostelium discoideum Cln5-like protein 1 (cln5la) is a homolog of human CLN5 found in the social amoeba Dictyostelium discoideum . The Dictyostelium discoideum genome encodes homologs for 11 of the 13 human CLN proteins . Dictyostelium Cln5 contains a signal peptide for secretion and is secreted during growth and starvation . Both Dictyostelium Cln5 and human CLN5 are glycoside hydrolases . Glycoside hydrolases are enzymes that catalyze the hydrolysis of glycosidic bonds in complex carbohydrates .

Role in Dictyostelium discoideum

In Dictyostelium discoideum, Cln5 is involved in various cellular and developmental processes :

  • Cell proliferation

  • Cytokinesis

  • Folic acid-mediated chemotaxis

  • Autophagy during growth

  • cAMP-chemotaxis

  • Aggregation

  • Developmental timing during multicellular development

Interactome of Cln5

Immunoprecipitation coupled with mass spectrometry has identified 61 proteins that interact with Cln5 in Dictyostelium . Of these proteins:

  • 67% localize to the extracellular space

  • 28% localize to intracellular vesicles

  • 20% localize to lysosomes

A GO term enrichment analysis revealed that a majority of the interacting proteins are involved in metabolism, catabolism, proteolysis, and hydrolysis, and include other NCL-like proteins (e.g., Tpp1/Cln2, cathepsin D/Cln10, cathepsin F/Cln13) as well as proteins linked to Cln3 function in Dictyostelium (e.g., AprA, CfaD, CadA) .

Relationship to Batten Disease

Mutations in the CLN5 gene cause a subtype of neuronal ceroid lipofuscinosis (NCL) called CLN5 disease . The precise function of CLN5 in the cell and the pathways regulating its function are not well understood . Dictyostelium discoideum serves as a complementary model system for studying the functions of proteins linked to NCL in humans, as residues that are glycosylated in human CLN5 are conserved in the Dictyostelium homolog, as are residues that are mutated in patients with CLN5 disease .

Cln5 as a Cysteine Palmitoyl Thioesterase

Cln5 exhibits cysteine palmitoyl thioesterase activity . The catalytic triad Cys280-His166-Glu183 plays a critical role in S-depalmitoylation activity . S-depalmitoylation is a rate-limiting step compared to the preceding S-palmitoylation, with barriers of 26.1 and 25.3 kcal/mol, respectively .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cln5la; DDB_G0271546; Cln5-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-378
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
cln5la
Target Protein Sequence
FTDTDEIVVLYLEAPLFFSKFGTLLANVNAFHSGLGFYSLNSNETYQVDFVAVPGVLESI LPNKIENGEIIWNTSGKVQFSDSIDNTGYWSSEKEIMTINNEIFETFLCWAQNYNESLSY YQLFDVLNRNTNELLVKSVVCNDFVWAGFNALYNLGGKYINDSIIASRDIVTLYTRESIE YVQDGSTNIEVISFYEAMLNISIPKNQTINGLIEELDELFKGNFYLYVNGDYYNVTLDSS PFSFAYSESPLPIGERDLSNITLLESCHFQHSSDNDIILNNKNGIGGWIFIIILLSFTTV YLVGGILINKFKNEKSGLDLIPNKDSWSSLGGLISDGFGFIKSKATGSTSGGNGYSSI
Uniprot No.

Target Background

Database Links
Protein Families
CLN5 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Cln5 and why is Dictyostelium discoideum used as a model to study it?

Cln5 is a protein linked to neuronal ceroid lipofuscinosis (NCL), commonly known as Batten disease, a devastating neurological disorder affecting all ages and ethnicities that is currently incurable . Dictyostelium discoideum serves as an excellent model organism for studying Cln5 because:

  • The Dictyostelium Cln5 homolog shares significant conservation with human CLN5, including glycosylation sites and residues that are mutated in patients with CLN5 disease .

  • Dictyostelium is haploid, simplifying gene disruption while still offering sexual and parasexual cycles for gene complementation studies .

  • It provides a cost-effective and easily culturable system with established genetic screening protocols .

  • As a single-cell organism that can transition to multicellularity, it offers reduced complexity compared to mammalian neuronal models while still providing insights into fundamental cellular processes .

What is the molecular function of Cln5 in Dictyostelium discoideum?

Research has established that Dictyostelium Cln5 functions as a glycoside hydrolase . This enzymatic activity represents the first concrete molecular function attributed to CLN5 in any system. Additionally, Cln5 in Dictyostelium:

  • Contains a putative signal peptide for secretion and is actively secreted during both growth and starvation phases .

  • Is glycosylated in the endoplasmic reticulum before being trafficked to the cell cortex and contractile vacuole system .

  • Interacts with a network of 61 proteins, with 67% localizing to the extracellular space, 28% to intracellular vesicles, and 20% to lysosomes .

  • Participates in protein interaction networks with other NCL-like proteins including Tpp1/Cln2, cathepsin D/Cln10, and cathepsin F/Cln13 .

  • Plays a role in regulating autophagy, evidenced by increased autophagic puncta and ubiquitinated proteins in cln5- cells .

How can I generate recombinant Dictyostelium Cln5 protein for in vitro studies?

To produce recombinant Dictyostelium Cln5:

  • Cloning strategy: Amplify the Dictyostelium cln5 gene (without the signal peptide for cytoplasmic expression) using PCR with appropriate restriction sites.

  • Expression system options:

    • Bacterial expression (E. coli BL21): Use for high yields but with potential glycosylation issues

    • Dictyostelium expression system: Preferred for native glycosylation patterns

    • Mammalian cell lines (HEK293): For complex post-translational modifications

  • Purification approach:

    • Include a His-tag or other affinity tag for simplified purification

    • Use immobilized metal affinity chromatography followed by size exclusion chromatography

    • For secreted protein, collect and concentrate culture media prior to purification

  • Quality control:

    • Verify glycosylation status using glycosidase treatment and mobility shift assays

    • Confirm glycoside hydrolase activity using appropriate synthetic substrates

How do I establish a cln5 knockout model in Dictyostelium discoideum?

Generating a cln5- knockout in Dictyostelium involves:

  • Construct design: Create a knockout cassette with a selectable marker (typically blasticidin resistance) flanked by homologous regions of the cln5 gene.

  • Transformation:

    • Prepare Dictyostelium cells (AX3 wild-type strain is commonly used)

    • Perform electroporation with the knockout construct

    • Select transformants on blasticidin-containing media

  • Knockout verification:

    • PCR screening to confirm the integration of the knockout cassette

    • Western blot to verify the absence of Cln5 protein

    • RT-PCR to confirm the absence of cln5 mRNA

  • Phenotypic characterization:

    • Growth curve analysis in both nutrient-rich and autophagy-stimulating media

    • Development on non-nutrient agar to assess developmental timing

    • Microscopy to evaluate autophagosome formation and protein ubiquitination

What assays can be used to study autophagy in cln5- Dictyostelium cells?

Several established assays can be employed to examine autophagy in cln5- Dictyostelium cells:

  • Autophagosome visualization:

    • GFP-Atg8 fluorescence microscopy to quantify autophagosome formation

    • LysoTracker staining to assess lysosomal compartments

  • Protein degradation assays:

    • Western blot analysis of ubiquitinated proteins

    • Proteasome activity measurements to distinguish between proteasomal and autophagic degradation

  • Growth and development studies:

    • Cell proliferation in autophagy-stimulating media

    • Development on water agar containing autophagy inhibitors (e.g., NH4Cl)

    • Measurement of slug size and development timing

  • Autofluorescent storage material:

    • Quantification of autofluorescent storage bodies (hallmark of CLN5 disease)

AssayWild-type (WT)cln5- cellsSignificance
Maximum cell densityHigherReducedImpaired growth in cln5- cells
Autophagy punctaBaselineIncreasedEnhanced autophagy induction
Ubiquitinated proteinsBaselineIncreasedAltered protein degradation
Development timingNormalAcceleratedPrecocious fruiting body formation
Slug sizeNormalReducedDevelopmental defects

How can I assess the glycoside hydrolase activity of recombinant Cln5?

To evaluate the glycoside hydrolase activity of recombinant Cln5:

  • Substrate selection:

    • Use synthetic glycoside substrates with chromogenic or fluorogenic leaving groups

    • Test various glycosidic linkages (α/β) and sugar moieties to determine specificity

  • Enzymatic assay setup:

    • Incubate purified recombinant Cln5 with substrate in appropriate buffer

    • Include positive controls (commercial glycosidases) and negative controls

    • Monitor reaction progress by measuring released chromophore/fluorophore

  • Kinetic analysis:

    • Determine Km and Vmax values at varying substrate concentrations

    • Evaluate pH and temperature optima for activity

    • Assess the effects of potential inhibitors

  • Validation in cellular context:

    • Compare activity of wild-type Cln5 with site-directed mutants corresponding to disease-causing mutations

    • Test activity in cell lysates from wild-type versus cln5- Dictyostelium cells

How can Dictyostelium Cln5 be used to understand the pathological mechanisms of human CLN5 disease?

Dictyostelium Cln5 provides valuable insights into CLN5 disease pathology through:

  • Comparative functional analysis:

    • Introduce human CLN5 disease-causing mutations into Dictyostelium Cln5

    • Assess the impact on glycoside hydrolase activity, protein localization, and secretion

    • Determine if mutations affect interaction with other NCL proteins

  • Interactome studies:

    • Compare the 61 proteins identified to interact with Cln5 in Dictyostelium with human homologs

    • Focus on interaction partners involved in metabolism, catabolism, proteolysis, and hydrolysis

    • Identify conserved pathways affected by CLN5 deficiency

  • Autophagy connection:

    • Investigate the mechanistic link between Cln5 deficiency and increased autophagy

    • Determine if autophagy enhancement is compensatory or pathological

    • Test autophagy modulators for their ability to rescue cln5- phenotypes

  • Therapeutic target identification:

    • Screen for compounds that can restore normal autophagy in cln5- cells

    • Evaluate the potential of glycoside hydrolase replacement therapy

    • Test whether secreted Cln5 can rescue cellular defects in a non-cell-autonomous manner

What is the relationship between Cln5 and other NCL proteins in Dictyostelium?

The interaction network between Cln5 and other NCL proteins in Dictyostelium reveals:

  • Physical interactions:

    • Cln5 interacts with homologs of human TPP1/CLN2, CTSD/CLN10, and CTSF/CLN13

    • These interactions suggest a shared pathway or converging pathways among NCL proteins

  • Functional relationships:

    • Compare phenotypes of different NCL protein knockout models in Dictyostelium

    • cln3- cells show increased proliferation and faster development, similar to some aspects of cln5- phenotypes

    • The developmental defects in cln5- cells can be modulated by Ca2+ chelation, similarly to cln3- cells

  • Lysosomal function:

    • Analyze the role of Cln5 in regulating lysosomal pH and enzyme activity

    • Investigate potential co-regulation of lysosomal proteins by Cln5

    • Explore the impact of Cln5 deficiency on the activity of other lysosomal hydrolases

NCL ProteinDictyostelium PhenotypeInteraction with Cln5Shared Cellular Processes
Cln3Increased proliferation, faster developmentIndirect (via shared interactors)Ca2+-dependent development
Tpp1/Cln2Substrate cleavage deficiencyDirect interactionLysosomal function
Cathepsin D/Cln10Not fully characterizedDirect interactionProteolysis
Cathepsin F/Cln13Not fully characterizedDirect interactionProteolysis

How can advanced imaging techniques be applied to study Cln5 trafficking and function?

Advanced imaging approaches for investigating Cln5:

  • Live-cell imaging with fluorescent protein fusions:

    • Generate Cln5-GFP fusion constructs ensuring retained functionality

    • Track intracellular trafficking from ER to cell cortex and contractile vacuole

    • Monitor secretion dynamics during growth and starvation phases

  • Super-resolution microscopy:

    • Employ STED or STORM microscopy to visualize Cln5 localization at nanoscale resolution

    • Co-localize Cln5 with interacting proteins and organelle markers

    • Analyze changes in distribution upon autophagy induction

  • FRET/BRET analysis:

    • Investigate protein-protein interactions in living cells

    • Measure real-time interactions between Cln5 and other NCL proteins

    • Assess how disease-causing mutations affect these interactions

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence microscopy with electron microscopy

    • Visualize ultrastructural changes in autophagosomes and lysosomes in cln5- cells

    • Track Cln5-containing vesicles during secretion and autophagy

How do I interpret contradictory findings between Dictyostelium and mammalian CLN5 models?

When facing discrepancies between model systems:

  • Comparative analysis approach:

    • Create a systematic comparison table of phenotypes across models

    • Identify core conserved functions versus species-specific adaptations

    • Consider differences in cellular context and protein expression levels

  • Evolutionary context:

    • Analyze protein sequence conservation focusing on functional domains

    • Consider divergent functions that may have evolved in different lineages

    • Examine conserved interacting proteins as indicators of shared pathways

  • Technical considerations:

    • Evaluate differences in experimental approaches and conditions

    • Consider developmental stage-specific effects in different models

    • Assess potential off-target effects in genetic models

  • Validation strategies:

    • Perform cross-species rescue experiments (human CLN5 in Dictyostelium cln5- cells)

    • Test specific biochemical functions (e.g., glycoside hydrolase activity) in multiple systems

    • Employ CRISPR/Cas9 to introduce identical mutations across model systems

What are the limitations of using Dictyostelium as a model for human CLN5 disease?

Important limitations to consider include:

  • Biological differences:

    • Dictyostelium lacks a nervous system, limiting direct neurodegeneration studies

    • Dictyostelium cells are rapidly dividing, unlike post-mitotic neurons

    • Some human CLN5 interacting partners may not have Dictyostelium homologs

  • Technical constraints:

    • Different post-translational modifications may affect protein function

    • The developmental cycle of Dictyostelium doesn't directly parallel human development

    • Pharmacological compounds may have different effects due to membrane permeability differences

  • Translational challenges:

    • Findings require validation in mammalian systems before clinical application

    • Some disease mechanisms may be specific to complex neural networks

    • Therapeutic approaches may need significant adaptation for human application

  • Complementary approaches:

    • Combine Dictyostelium studies with mammalian cell models and animal models

    • Use Dictyostelium for high-throughput screening and mechanism discovery

    • Validate key findings in patient-derived cells or tissues

How can I integrate multi-omics data to better understand Cln5 function in Dictyostelium?

A comprehensive multi-omics approach includes:

  • Data integration strategy:

    • Combine transcriptomics, proteomics, metabolomics, and interactomics data

    • Use pathway enrichment analysis across multiple datasets

    • Employ network analysis to identify regulatory hubs connected to Cln5

  • Temporal analysis:

    • Compare profiles across Dictyostelium's developmental stages

    • Identify transitional changes in gene expression and protein abundance

    • Correlate Cln5 expression patterns with interacting partners

  • Functional clustering:

    • Group genes/proteins with similar expression patterns

    • Identify enriched biological processes in co-regulated clusters

    • Focus on processes related to lysosomal function, autophagy, and development

  • Visualization and interpretation:

    • Create integrated network models highlighting Cln5-centered interactions

    • Identify critical nodes that might serve as therapeutic targets

    • Generate testable hypotheses about Cln5 function based on multi-omics patterns

Data TypeKey Finding in cln5- CellsIntegration Point
TranscriptomicsAltered expression of autophagy-related genesCorrelate with proteome changes
ProteomicsIncreased ubiquitinated proteinsConnect to metabolic alterations
Interactomics61 Cln5-interacting proteins identifiedMap to transcriptional changes
MetabolomicsChanges in lysosomal metabolitesLink to cellular phenotypes

How can Dictyostelium Cln5 studies inform therapeutic approaches for CLN5 disease?

Dictyostelium Cln5 research offers several translational insights:

  • Enzyme replacement strategies:

    • Recombinant Cln5 with its glycoside hydrolase activity could potentially restore function

    • Test whether extracellular application of purified Cln5 rescues cellular defects

    • Evaluate different delivery methods for enzyme replacement therapy

  • Small molecule screening:

    • Use Dictyostelium cln5- cells for high-throughput screening of compound libraries

    • Identify molecules that restore normal autophagy patterns

    • Test compounds that enhance the secretion or activity of residual Cln5 in disease models

  • Gene therapy approaches:

    • Evaluate AAV9-mediated CLN5 gene delivery efficacy in Dictyostelium and animal models

    • Compare intravitreal delivery to other administration routes

    • Test the efficacy of CLN5 gene therapy in attenuating retinal dysfunction, as demonstrated in ovine models

  • Autophagy modulation:

    • Test whether normalizing autophagy through pharmacological means rescues cln5- phenotypes

    • Investigate the therapeutic potential of autophagy enhancers or inhibitors

    • Examine if restoring Cln5 glycoside hydrolase activity normalizes autophagy

What experimental methods can validate potential therapeutic targets identified in Dictyostelium Cln5 studies?

Validation approaches for therapeutic targets include:

  • Target validation pipeline:

    • Confirm target expression and conservation in human cells

    • Perform CRISPR/Cas9 knockout/knockdown of targets in mammalian cells

    • Test for rescue of CLN5 disease phenotypes in patient-derived cells

  • Pharmacological validation:

    • Use existing approved drugs that modulate the target

    • Employ specific inhibitors/activators to assess dose-dependent effects

    • Compare effects across multiple model systems (Dictyostelium, mammalian cells, animal models)

  • In vivo validation:

    • Test promising approaches in CLN5 disease animal models

    • Assess both biochemical rescue and functional improvement

    • Evaluate long-term efficacy and potential side effects

  • Translational considerations:

    • Assess blood-brain barrier penetration for CNS-targeted therapeutics

    • Evaluate tissue-specific effects, particularly in neuronal cells

    • Consider combination approaches targeting multiple disease mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.