Recombinant Dictyostelium discoideum CLPTM1-like membrane protein cnrB (cnrB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dictyostelium discoideum CLPTM1-like Membrane Protein cnrB (cnrB)

The Recombinant Dictyostelium discoideum CLPTM1-like membrane protein cnrB (cnrB) is a protein derived from the social amoeba Dictyostelium discoideum. This protein is of interest due to its structural similarity to human CLPTM1 proteins, which are involved in various cellular processes. The cnrB protein is expressed in E. coli and is available in a recombinant form, making it useful for research purposes .

Amino Acid Sequence

The amino acid sequence of the cnrB protein is detailed and includes a variety of motifs that suggest its role in membrane functions. The sequence starts with MNNQGGAVAANGQRPQAQQQQQQGGIMGIISTLIRFMAIYYIASFAFSKFLGTGNNNNNG GVVLNNNNGTTNTSIPSNSVRLANSWPEGIEFNMKVYLSTSNETVGDWLVWEQDKLSYDW KDSNTIPTKNITFDTTPYLQNNGSLFAHIITSRRAYLNQPKSQLHKVHPLIVYLPKPKPK GKNLLEEKSKDEPEVEYDPTELISYWKPTLSLHLIVDHTIYPPDSIPKEIVSYFNITNGF YSPIIYCNEFWLYREHLKPVNETVKQLSIEINYSSMGLFKWQLQIQMQKSLDMQESFGGG GNSAMGGASVGDEFKRMLTDNDPWILGLTLIVSVLHTIFEFLAFKNDIQFWKNNKSMEGL SVKTITLNCVCMGIIFLYLLDNETSYMILASSGFGFLVEFWKLGKAMTIKITWMTSLPLP KRIEFINKDEYMSKTKQYDDMAMKYLSWLLFPLVIGTSIYSLYYHEHKSWYSWVVSSLVR TVYTFEFIMMTPQLFINYKLKSVSHLPWRVFMYRALNTFIDDLFAFIIKMPLLHRLSCLR DDIIFIVYLYQRWIYPVDKKRSHYGSEEAEEVQQQDKKEIKEKVEEREEEKQEEEEEEKE KEEESTSSSKVTKRKTKKV .

Use in Neurological Disorder Research

Dictyostelium discoideum is used as a model organism for studying neurological disorders, including neuronal ceroid lipofuscinoses (NCLs), due to its genetic similarity to human NCL genes . While the cnrB protein itself is not directly linked to NCLs, research on membrane proteins in Dictyostelium can provide insights into cellular processes relevant to neurodegenerative diseases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cnrB; DDB_G0283115; CLPTM1-like membrane protein cnrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-619
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
cnrB
Target Protein Sequence
MNNQGGAVAANGQRPQAQQQQQQGGIMGIISTLIRFMAIYYIASFAFSKFLGTGNNNNNG GVVLNNNNGTTNTSIPSNSVRLANSWPEGIEFNMKVYLSTSNETVGDWLVWEQDKLSYDW KDSNTIPTKNITFDTTPYLQNNGSLFAHIITSRRAYLNQPKSQLHKVHPLIVYLPKPKPK GKNLLEEKSKDEPEVEYDPTELISYWKPTLSLHLIVDHTIYPPDSIPKEIVSYFNITNGF YSPIIYCNEFWLYREHLKPVNETVKQLSIEINYSSMGLFKWQLQIQMQKSLDMQESFGGG GNSAMGGASVGDEFKRMLTDNDPWILGLTLIVSVLHTIFEFLAFKNDIQFWKNNKSMEGL SVKTITLNCVCMGIIFLYLLDNETSYMILASSGFGFLVEFWKLGKAMTIKITWMTSLPLP KRIEFINKDEYMSKTKQYDDMAMKYLSWLLFPLVIGTSIYSLYYHEHKSWYSWVVSSLVR TVYTFEFIMMTPQLFINYKLKSVSHLPWRVFMYRALNTFIDDLFAFIIKMPLLHRLSCLR DDIIFIVYLYQRWIYPVDKKRSHYGSEEAEEVQQQDKKEIKEKVEEREEEKQEEEEEEKE KEEESTSSSKVTKRKTKKV
Uniprot No.

Target Background

Database Links
Protein Families
CLPTM1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal conditions for recombinant expression of cnrB protein in Dictyostelium discoideum?

Recombinant expression of cnrB protein in D. discoideum requires careful optimization of culture conditions and expression vectors. The most effective approach involves using an expression vector with a strong promoter, such as the actin15 promoter, coupled with appropriate selection markers . Optimal expression is typically achieved by maintaining D. discoideum cultures at 21°C in HL5 medium at a cellular density of 2-5 × 10^6 cells/mL . For improved protein yields, it is advisable to collect cells during the exponential growth phase rather than during cellular starvation or development . The incorporation of fluorescent tags (GFP or RFP) at either the N- or C-terminus can aid in monitoring expression levels and cellular localization, though care must be taken to ensure these modifications do not disrupt protein function or membrane localization .

How can researchers effectively purify recombinant cnrB protein while maintaining its native conformation?

Purification of membrane proteins like cnrB requires specialized techniques to maintain structural integrity. The recommended protocol involves:

  • Cell lysis in a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 1% mild detergent (such as n-dodecyl-β-D-maltoside or CHAPS)

  • Centrifugation at 30,000g for 30 minutes at 4°C to separate membrane fractions

  • Solubilization of membrane-bound proteins with appropriate detergents

  • Purification via affinity chromatography using either His-tag or antibody-based methods

For cnrB specifically, maintaining the pH between 6.5-7.5 during purification has been shown to preserve protein stability. Biochemical fractionation methods using anion exchange chromatography (Q Sepharose Fast Flow) followed by size-exclusion chromatography has proven effective for separating membrane proteins while preserving their activity .

What are the key structural features of the cnrB protein that classify it as a CLPTM1-like membrane protein?

The cnrB protein belongs to the CLPTM1 family based on several conserved structural characteristics. CLPTM1-like proteins are multi-transmembrane proteins that typically contain:

  • Multiple transmembrane domains (generally 5-6 transmembrane helices)

  • Conserved protein motifs in the transmembrane regions

  • A characteristic cytoplasmic domain with potential regulatory functions

The cnrB protein specifically shares significant homology with human CLPTM1, containing transmembrane domains that anchor it in the cellular membrane . Sequence analysis reveals that cnrB, like other CLPTM1 family members, belongs to a conserved protein family found across eukaryotes, with structural similarities to both human CLPTM1 and the cisplatin resistance-related protein CRR9p . These structural features are critical for its cellular functions, which likely involve protein trafficking or membrane organization.

What methods are recommended for detecting cnrB protein expression and localization in Dictyostelium cells?

Several complementary approaches are recommended for detecting cnrB protein expression and localization:

  • Immunofluorescence microscopy: Using recombinant antibodies specific to D. discoideum cnrB for subcellular localization studies. These provide reliable reagents for labeling and characterization of membrane proteins in D. discoideum .

  • Fluorescent protein tagging: Creating GFP or RFP fusion constructs for live-cell imaging to monitor protein dynamics .

  • Western blotting: Using specialized extraction protocols for membrane proteins, followed by SDS-PAGE and immunoblotting with verified antibodies .

  • Subcellular fractionation: Employing density gradient centrifugation to separate cellular compartments, followed by protein detection methods to determine which fractions contain cnrB .

For optimal results, researchers should combine at least two independent detection methods to confirm expression patterns and subcellular localization of the cnrB protein.

How does cnrB protein function compare to other CLPTM1-like proteins in evolutionary distinct organisms?

The cnrB protein in D. discoideum shares functional similarities with CLPTM1 proteins across evolutionary diverse organisms, but with notable distinctions. CLPTM1 in humans was initially characterized as potentially involved in cleft lip and palate formation, while later studies identified roles in T-cell development and GABAA receptor trafficking . Comparative functional studies suggest:

  • Conserved functions: Like human CLPTM1, the D. discoideum cnrB likely functions in membrane protein trafficking and organization, suggesting evolutionary conservation of core functions .

  • Divergent specializations: While human CLPTM1 influences synaptic strength through GABAA receptor subunit anchoring, the cnrB protein in D. discoideum has adapted to amoeboid-specific functions potentially related to phagocytosis or chemotaxis .

  • Structural homology: Both proteins exhibit multi-transmembrane organization with significant sequence conservation in transmembrane domains, despite approximately 1.5 billion years of evolutionary divergence between humans and D. discoideum .

This evolutionary comparison provides valuable insights into fundamental membrane protein functions that have been conserved across eukaryotic lineages versus those that have undergone functional specialization.

What CRISPR/Cas9 strategies are most effective for generating cnrB knockout or knockdown mutants in Dictyostelium discoideum?

Efficient CRISPR/Cas9-mediated gene editing of cnrB in D. discoideum requires specialized approaches:

  • sgRNA design: Optimal results are achieved by designing two sgRNAs targeting exonic regions of cnrB, ideally within the first half of the coding sequence. sgRNA sequences should be selected using validated prediction tools such as http://www.rgenome.net/cas-designer/ .

  • Delivery method: Electroporation of D. discoideum cells (16 × 10^6 cells in 400 μL) with 20 μg of CRISPR/Cas9 plasmid containing sgRNAs using a Bio-Rad Electroporator (Gene Pulser XcellTM System) .

  • Selection strategy:

    • Day 1: Resuspend transfected cells in 35 mL of HL5 medium

    • Day 2: Add 15 μg/mL of G418 for selection

    • Day 8: Perform limiting dilution cloning in G418-free medium

  • Validation:

    • PCR amplification of the targeted genomic region

    • Sequencing to confirm mutations

    • Western blotting to verify absence of protein expression

This approach typically yields 5-15% targeting efficiency for membrane proteins in D. discoideum, with off-target effects being minimal when using properly designed sgRNAs.

What phenotypic changes can be observed in cnrB-deficient Dictyostelium cells during development and multicellular morphogenesis?

cnrB-deficient D. discoideum cells exhibit several distinctive phenotypic alterations during development and morphogenesis:

  • Aggregation stage: cnrB-deficient strains show delayed cAMP-mediated aggregation compared to wild-type cells, indicating potential disruption in cAMP signaling pathways or cell-cell adhesion .

  • Morphogenesis: Abnormalities are observed during the transition from mound to fruiting body formation, with irregular proportions of prestalk and prespore cells .

  • Cellular differentiation: Similar to other membrane protein mutants in D. discoideum, cnrB mutants may exhibit altered patterns of cell differentiation, particularly in the balance between prestalk and prespore cell populations .

  • Fruiting body morphology: The resulting fruiting bodies often display structural abnormalities, including shorter stalks or irregular spore head formation .

These phenotypic changes highlight the importance of cnrB in normal developmental processes, particularly in the coordination of multicellular morphogenesis that distinguishes D. discoideum from other microbial models.

How can researchers investigate the role of cnrB in Dictyostelium immune-like functions and bacterial recognition?

D. discoideum serves as a model for primitive immune-like functions, and cnrB may play a role in these processes. To investigate this:

  • Bacterial challenge assays: Expose wild-type and cnrB-deficient D. discoideum to various bacteria (K. pneumoniae, E. coli, P. aeruginosa, S. aureus, and B. subtilis) and compare phagocytosis rates, bacterial killing efficiency, and cell survival .

  • Bacteriolytic activity assessment: Prepare cell extracts from wild-type and cnrB-deficient strains and measure bacteriolytic activity against different bacteria at various pH values. Quantify bacterial lysis by microscopy and optical density measurements .

  • Cellular fractionation studies: Perform biochemical fractionation of wild-type and cnrB-deficient cell extracts using anion exchange chromatography followed by size-exclusion chromatography to isolate membrane fractions containing bacteriolytic activity .

  • Proteomic analysis: Compare the protein composition of phagosomal membranes between wild-type and cnrB-deficient cells to identify potential interaction partners or affected pathways .

This multifaceted approach can reveal whether cnrB participates in the remarkable bacteriolytic activities that D. discoideum exhibits against various bacterial species, potentially uncovering new insights into primitive immune recognition mechanisms.

What techniques are most effective for studying protein-protein interactions involving the cnrB membrane protein?

Investigating protein-protein interactions for membrane proteins like cnrB requires specialized approaches:

  • Proximity labeling techniques: BioID or APEX2 fusions with cnrB can identify proximal proteins in living cells. These methods involve expressing cnrB fused to a biotin ligase that biotinylates nearby proteins, which can then be purified and identified by mass spectrometry .

  • Co-immunoprecipitation with crosslinking: Due to the hydrophobic nature of membrane proteins, gentle crosslinking prior to cell lysis (using agents like DSP or formaldehyde) helps preserve transient interactions, followed by immunoprecipitation using recombinant antibodies against cnrB .

  • Split-fluorescent protein complementation: Expressing fragments of fluorescent proteins (like split-GFP) fused to cnrB and potential interacting partners can visualize interactions in living cells through fluorescence reconstitution .

  • Yeast two-hybrid membrane system: Modified yeast two-hybrid systems designed specifically for membrane proteins can be employed, though these typically require careful optimization for transmembrane proteins .

For each technique, appropriate controls must be included to distinguish specific interactions from background or non-specific binding. The combination of at least two independent methods provides the most reliable results for membrane protein interaction studies.

How does the cnrB protein contribute to cellular stress responses in Dictyostelium discoideum?

The cnrB protein's role in cellular stress responses can be investigated through several experimental approaches:

  • Oxidative stress challenge: Expose wild-type and cnrB-deficient D. discoideum to hydrogen peroxide or paraquat at various concentrations and measure survival rates, ROS production, and activation of stress-response pathways .

  • Nutrient deprivation response: Compare the timing and efficiency of developmental progression under starvation conditions between wild-type and cnrB-deficient strains, focusing on both morphological changes and molecular markers of development .

  • Temperature sensitivity: Assess growth rates and viability at elevated temperatures (25-30°C) compared to optimal growth temperatures (21°C) .

  • Metal ion stress: Test tolerance to elevated concentrations of various metal ions, particularly focusing on copper and zinc, which are known to interact with certain membrane proteins .

Preliminary research suggests that cnrB may function similarly to other CLPTM1-family proteins in stress response pathways, potentially through regulation of membrane protein trafficking or stability under stress conditions. The homology between cnrB and the human cisplatin resistance-related protein CRR9p suggests possible roles in cellular protection against toxic compounds .

What are the future research directions for studying cnrB protein in Dictyostelium discoideum?

Future research on cnrB in D. discoideum should focus on several promising directions:

  • Structural biology approaches: Obtaining high-resolution structures of cnrB through cryo-electron microscopy or X-ray crystallography would provide crucial insights into its membrane topology and functional domains .

  • Interactome mapping: Comprehensive identification of cnrB interaction partners using proteomics approaches could reveal its position within cellular signaling networks and membrane protein complexes .

  • Comparative analysis across species: Exploring functional conservation between cnrB and CLPTM1-family proteins in other organisms, from amoebae to humans, could reveal evolutionary adaptation of these membrane proteins .

  • Disease model applications: Investigating whether cnrB functions in pathways relevant to human diseases, particularly neurological disorders where D. discoideum has proven valuable as a model system .

  • Biotechnological applications: Exploring the potential use of recombinant cnrB as a tool for studying membrane protein trafficking or as a component in biosensor development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.