Recombinant Dictyostelium discoideum Cyclic AMP receptor 1 (carA-1)

Shipped with Ice Packs
In Stock

Description

Definition and Production of Recombinant Dictyostelium discoideum Cyclic AMP Receptor 1 (carA-1)

Recombinant Dictyostelium discoideum Cyclic AMP Receptor 1 (carA-1), also known as cAR1, is a genetically engineered protein produced in heterologous systems (e.g., E. coli, yeast, baculovirus, or mammalian cells) to study its structure, function, and signaling mechanisms . This recombinant form retains the functional properties of the native receptor, enabling precise biochemical and physiological analyses .

Biological Role and Developmental Significance

carA-1 is a G-protein-coupled receptor (GPCR) critical for the aggregation phase of Dictyostelium development. When nutrients are depleted, cAMP acts as a chemoattractant, guiding amoebae to form a multicellular organism. carA-1 mediates this response by activating downstream pathways, including G-protein signaling and cAMP-dependent protein kinase (PKA) .

Experimental Evidence

  • Null Mutant Phenotype: carA-1 knockout mutants fail to bind cAMP, arrest in early development, and cannot aggregate .

  • Rescue Experiments: Constitutive expression of carA-1 cDNA restores aggregation and development, confirming its essential role .

  • Temporal Expression: carA-1 mRNA peaks at 3–4 hours post-starvation, aligning with the initiation of aggregation .

Functional Insights

  • cAMP Sensing: carA-1 triggers Ca²⁺ influx within seconds of ligand binding, a critical step in chemotaxis .

  • Signal Transduction: Activates Gα2 subunits, leading to PIP₃ production and PKA activation .

  • Regulation by Arrestins: Arrestin domain-containing proteins (e.g., AdcC) modulate cAMP oscillation frequency and receptor internalization .

Developmental Regulation and Gene Expression

  • cAMP-Dependent Gene Activation: carA-1 expression is induced by cAMP pulses, enabling the transcription of genes required for aggregation (e.g., carA, gbaB) .

  • Antisense RNA Knockdown: carA-1 antisense RNA abolishes receptor protein expression, preventing aggregation .

Interactions with Downstream Signaling Molecules

MoleculeRole in carA-1 Signaling
Gα2Couples carA-1 activation to PIP₃ production and chemotaxis
PKAMediates transcriptional responses to cAMP pulses
Arrestins (AdcB/AdcC)Regulate cAMP oscillation frequency and ERK2 activation

Applications in Toxicity and Developmental Studies

  • Toxicity Screening: Dictyostelium models using carA-1 mutants evaluate developmental toxicity, with results correlating with mammalian data .

  • Signaling Pathway Mapping: carA-1 is used to study GPCR trafficking, phosphorylation, and desensitization .

Comparative Analysis of carA-1 with Other cAMP Receptors

ReceptorStage of ExpressioncAMP AffinityFunction
carA-1Early aggregationHighInitiates aggregation and chemotaxis
carA-2/4Pre-stalk cells (slug stage)ModerateRegulates cell-type differentiation
carA-3Mound stageLowFacilitates morphogenesis

Data compiled from sources .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing it accordingly.
Synonyms
carA-1; car1; DDB_G0273397; carA-2; DDB_G0273533; Cyclic AMP receptor 1; cAMP receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
carA-1
Target Protein Sequence
MGLLDGNPANETSLVLLLFADFSSMLGCMAVLIGFWRLKLLRNHVTKVIACFCATSFCKD FPSTILTLTNTAVNGGFPCYLYAIVITYGSFACWLWTLCLAISIYMLIVKREPEPERFEK YYYLLCWGLPLISTIVMLAKNTVQFVGNWCWIGVSFTGYRFGLFYGPFLFIWAISAVLVG LTSRYTYVVIHNGVSDNKEKHLTYQFKLINYIIVFLVCWVFAVVNRIVNGLNMFPPALNI LHTYLSVSHGFWASVTFIYNNPLMWRYFGAKILTVFTFFGYFTDVQKKLEKNKNNNNPSP YSSSRGTSGKTMGGHPTGDDVQCSSDMEQCSLERHPNMVNNQQNLNNNYGLQQNYNDEGS SSSSLSSSDEEKQTVEMQNIQISTSTNGQGNN
Uniprot No.

Target Background

Function
This protein serves as a receptor for cAMP. It plays a crucial role in coordinating the aggregation of individual cells into a multicellular organism and regulates the expression of a wide range of developmentally regulated genes. The activity of this receptor is mediated by G proteins.
Database Links
Protein Families
G-protein coupled receptor 5 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum Cyclic AMP receptor 1 (carA-1)?

Cyclic AMP receptor 1 (carA-1) is a cell surface receptor in Dictyostelium discoideum that plays a critical role in developmental signaling. It functions as a G protein-coupled receptor (GPCR) that specifically binds extracellular cAMP. The receptor is comprised of seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus. CarA-1 is essential for initiating the developmental program in Dictyostelium upon starvation, serving as the primary sensor for extracellular cAMP signals during the growth-to-differentiation transition (GDT) . The receptor is part of a complex signaling cascade that regulates aggregation, cell fate determination, and morphogenesis during the multicellular development of this social amoeba.

How does carA-1 function in the cAMP signaling pathway during Dictyostelium development?

In Dictyostelium, carA-1 functions as the primary sensor in the cAMP signaling pathway, which is activated upon starvation. When activated, carA-1 triggers a complex signaling cascade involving the following components:

  • Upon binding cAMP, carA-1 activates associated heterotrimeric G-proteins, particularly GpaB (one of the G-protein alpha subunits) .

  • This activation leads to downstream signaling events including the stimulation of the aggregative adenylyl cyclase (AcaA) which produces intracellular cAMP .

  • The activated pathway also involves protein kinase A (PKA), which is critical for developmental progression .

  • The YakA kinase serves as an upstream regulator that links nutrient sensing to the initiation of the cAMP signaling system .

This pathway is essential for coordinating collective cell behavior during aggregation and is part of the mechanism that allows Dictyostelium cells to commit to development rather than reverting to growth when nutrients become available again .

What phenotypes are observed in carA-1 knockout mutants?

Studies of carA-1 knockout (carA-) mutants reveal several distinct phenotypes that highlight the critical role of this receptor in Dictyostelium development:

  • Failure to undergo developmental commitment - carA- cells fail to commit to development when challenged with nutrient sources even after prolonged starvation .

  • Persistent phagocytic ability - While wild-type cells lose their ability to phagocytose between 4-6 hours of starvation, carA- mutants retain phagocytic capability even after 9 hours of starvation .

  • Developmental arrest - carA- cells are unable to proceed through the normal developmental program due to their inability to respond to extracellular cAMP signals .

  • Defective aggregation - Without functional carA-1, cells cannot detect and respond to cAMP gradients, preventing them from undergoing chemotaxis toward aggregation centers .

These phenotypes clearly demonstrate that carA-1 is essential for initiating and progressing through the developmental cycle of Dictyostelium discoideum.

What expression systems are most effective for producing functional recombinant carA-1?

The production of functional recombinant carA-1 presents significant challenges due to its multi-transmembrane domain structure. Based on research practices with similar GPCRs, several expression systems have proven effective, each with distinct advantages:

Expression SystemAdvantagesChallengesTypical Yield
E. coliRapid growth, low cost, easy genetic manipulationOften forms inclusion bodies, difficult membrane insertion0.1-0.5 mg/L culture
Pichia pastorisPost-translational modifications, proper foldingLonger expression time, complex media requirements1-2 mg/L culture
Baculovirus-infected insect cellsNear-native folding, high expression levelsComplex setup, higher cost2-5 mg/L culture
Dictyostelium cellsNative environment, proper folding and modificationsLower yields, more complex purification0.5-1 mg/L culture

For functional studies of carA-1, homologous expression in Dictyostelium cells (particularly carA- strains) often provides the most physiologically relevant results despite lower yields. For structural studies requiring higher protein amounts, optimized baculovirus-infected insect cells often represent the best compromise between yield and functionality.

What purification strategies yield the highest purity and activity for recombinant carA-1?

Purification of recombinant carA-1 requires careful consideration of its membrane-bound nature. The following stepwise approach has been found to maintain receptor activity while achieving high purity:

  • Membrane isolation: Gentle cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Solubilization: Careful selection of detergents is critical - typically mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations just above their CMC (critical micelle concentration).

  • Affinity chromatography: Utilizing tags like His6 or FLAG, with consideration for their placement to minimize interference with receptor function.

  • Size exclusion chromatography: To separate monomeric receptor from aggregates and contaminants.

Activity assessment should be performed at each purification step using ligand binding assays to ensure the protein maintains its native conformation. Special attention must be given to maintaining a stable lipid environment throughout purification, as this significantly impacts receptor stability and function.

How does the structure-function relationship of recombinant carA-1 compare to other cAMP receptors?

The structure-function relationship of carA-1 provides valuable insights into GPCR evolution and signaling mechanisms:

FeaturecarA-1Mammalian cAMP receptors (e.g., β-adrenergic)Functional Significance
cAMP binding pocketExtracellularIntracellular (for PKA/EPAC)Different signaling paradigm
G-protein couplingPrimarily Gα2 in DictyosteliumVarious Gα subunitsReflects evolutionary specialization
Phosphorylation sitesMultiple in C-terminusSimilar pattern in C-terminusConserved regulation mechanism
DesensitizationRapid adaptationSimilar mechanismsFundamental GPCR property
OligomerizationForms dimersSimilar dimerizationConserved activation mechanism

While mammalian cells do not have direct homologs of carA-1 (they sense cAMP intracellularly through PKA and EPAC), the carA-1 receptor shares core structural and functional properties with mammalian GPCRs. This makes it a valuable model for studying fundamental aspects of GPCR biology in a genetically tractable system.

How does carA-1 expression change during the Dictyostelium life cycle?

The expression of carA-1 is tightly regulated throughout the Dictyostelium life cycle, reflecting its central role in development:

Developmental StagecarA-1 Expression LevelCellular EventsRegulatory Factors
Vegetative growthMinimal/basalCell division, phagocytosisRepressed by nutrients
Early starvation (0-2h)Rapidly increasingInitiation of developmentYakA kinase activation
Aggregation (4-8h)Peak expressionChemotaxis, loss of phagocytosisPositive feedback via cAMP signaling
Mound formation (8-12h)Sustained high levelsCell differentiation beginsContinued cAMP signaling
Culmination (16-24h)DecreasingTerminal differentiationDevelopmental progression

The expression profile of carA-1 shows that it is rapidly upregulated during early starvation as part of the growth-to-differentiation transition (GDT) . This upregulation coincides with the period when cells begin to lose their phagocytic ability (between 4-6 hours of starvation in wild-type cells) . The tight correlation between carA-1 expression, commitment to development, and loss of phagocytosis underscores the receptor's pivotal role in developmental decision-making.

What is the relationship between carA-1 signaling and developmental commitment?

Research has established a clear causal relationship between carA-1 signaling and developmental commitment in Dictyostelium:

  • Timing correlation: The commitment to development occurs after a few hours of starvation, coinciding with the period of carA-1 upregulation and activation .

  • Genetic evidence: carA- mutant cells fail to commit to development and continue to phagocytose bacteria even after 9 hours of starvation, demonstrating that carA-1 is necessary for commitment .

  • Signaling dependency: Other components of the cAMP signaling pathway (acaA, gpaB, yakA) are also required for commitment, indicating that the entire pathway downstream of carA-1 is essential .

  • Physiological connection: The loss of phagocytosis, which occurs between 4-6 hours in wild-type cells but not in carA- mutants, appears to be tightly linked to commitment, though not causally responsible for it .

The cAMP signaling initiated by carA-1 appears to trigger irreversible changes in gene expression and cellular physiology that mark the point of no return in development. This mechanism ensures that transient exposure to nutrients after sufficient starvation does not disrupt the developmental program, allowing Dictyostelium aggregates to complete development even when crossing bacterial lawns .

How do researchers experimentally determine the point of developmental commitment in relation to carA-1 function?

Researchers employ several methodologies to precisely determine the point of developmental commitment in relation to carA-1 function:

  • Bacterial challenge assay: Developing cells are challenged with bacteria at various time points to determine when they no longer revert to growth. This approach revealed that wild-type cells commit to development after a few hours of starvation, while carA- mutants fail to commit .

  • Phagocytosis assay: Cells are incubated with fluorescent beads at different developmental time points to assess phagocytic capability:

    • Protocol: 5 μl of fluorescent beads (Dragon Green-labeled polystyrene beads, 0.52-μm diameter) are added to 20 μl of cell suspension (2×10^8 cells/ml)

    • Incubation: 30 minutes on KK2 agar

    • Processing: Cells are washed three times with KK2 containing 20 mM EDTA, fixed with 2% formaldehyde

    • Analysis: Phagocytosis efficiency = (number of cells containing ≥3 beads/total number of cells) × 100

  • Diffusible factor analysis: Using nitrocellulose filters (0.45 μm) and dialysis tubing (12-14 kDa), researchers can test whether soluble factors (like amino acids) can reverse commitment, helping to delineate the molecular mechanisms downstream of carA-1 .

  • Gene expression profiling: Temporal analysis of gene expression changes following starvation helps identify the transcriptional program activated by carA-1 signaling that mediates commitment.

These approaches collectively demonstrate that carA-1-mediated cAMP signaling is the critical trigger for developmental commitment, occurring between 4-6 hours after the onset of starvation.

How can recombinant carA-1 be used to study GPCR signal transduction mechanisms?

Recombinant carA-1 offers several unique advantages for studying fundamental GPCR signaling mechanisms:

  • Reconstitution systems: Purified recombinant carA-1 can be reconstituted into artificial membrane systems (liposomes, nanodiscs) along with purified G-proteins to study direct receptor-G-protein coupling kinetics and specificity.

  • Conformational dynamics: Site-specific labeling of recombinant carA-1 with fluorophores or spin labels enables researchers to monitor conformational changes during activation using techniques such as:

    • FRET (Förster Resonance Energy Transfer)

    • EPR (Electron Paramagnetic Resonance)

    • Single-molecule spectroscopy

  • Biased signaling analysis: By introducing specific mutations in recombinant carA-1, researchers can investigate how structural changes affect the balance between different downstream signaling pathways (G-protein vs. arrestin-mediated), providing insights into GPCR biased signaling.

  • Cross-species chimeras: Creating chimeric receptors between carA-1 and mammalian GPCRs allows identification of critical domains for specific signaling functions, leveraging the evolutionary distance between these receptors to highlight conserved mechanisms.

The relatively simple genetic system of Dictyostelium combined with the ability to produce and manipulate recombinant carA-1 makes this an excellent model for dissecting fundamental aspects of GPCR biology that are relevant across species.

What strategies can overcome challenges in crystallizing recombinant carA-1 for structural studies?

Obtaining high-resolution structural data for carA-1 presents significant challenges common to membrane proteins. Researchers have developed several strategies to address these issues:

ChallengeSolution StrategyOutcome
Conformational heterogeneityUse of conformation-stabilizing antibodies or nanobodiesStabilizes specific receptor states
Detergent micelle limitationsReconstitution in lipidic cubic phase (LCP)Provides more native-like environment
Flexible regions interfering with crystal contactsTruncation of N/C termini, loop engineeringRemoves disordered regions while preserving function
Low expression yieldsFusion with crystallization chaperones (e.g., T4 lysozyme)Increases expression and provides crystal contacts
Limited stabilityAlanine-scanning mutagenesis to identify stabilizing mutationsIdentifies thermostabilizing mutations
Glycosylation heterogeneityExpression in insect cells with glycosylation inhibitorsProduces more homogeneous protein population

The combination of these approaches, particularly the use of lipidic cubic phase crystallization, has proven successful for other GPCRs and shows promise for carA-1. Additionally, newer techniques like cryo-electron microscopy (cryo-EM) are becoming increasingly viable alternatives to crystallography for membrane protein structure determination, especially for larger complexes of carA-1 with its signaling partners.

How does the function of carA-1 compare to other developmental receptors in Dictyostelium?

Dictyostelium utilizes multiple receptor systems during development, with carA-1 playing a central but not exclusive role:

ReceptorLigandDevelopmental RoleRelationship to carA-1
carA-1cAMPPrimary chemotaxis, aggregation, developmental commitment-
carB, carC, carDcAMPLater development, cell type differentiationPartially redundant with carA-1 in some contexts
crlA (cAR-like)UnknownInvolved in prestarvation responseActs upstream of carA-1
fAR1FolateBacterial sensing, phagocytosisActive during growth phase when carA-1 is repressed
crlA (cmfA receptor)CMFEnsures critical density for aggregationWorks in concert with carA-1 signaling
dscA-C receptorsDiscoidinsCell-cell adhesion during developmentFunction downstream of carA-1 activation

This complex network of receptors allows Dictyostelium to integrate multiple environmental and intercellular signals during development. Research indicates that while carA-1 is the primary receptor for initiating development upon starvation, its signaling intersects with other pathways to ensure proper coordination of multi-cellular development. The commitment process mediated by carA-1 represents a critical decision point that overrides other signaling inputs, ensuring developmental progression once initiated .

What are the most reliable assays for measuring recombinant carA-1 binding activity?

Accurately measuring the binding activity of recombinant carA-1 is crucial for functional characterization. Several complementary approaches provide robust data:

  • Radioligand binding assays:

    • Direct binding: [³H]cAMP or [¹²⁵I]cAMP binding to membrane preparations or purified receptor

    • Competition binding: Displacement of radiolabeled cAMP by unlabeled ligands

    • Saturation binding: Determination of Kd and Bmax values

    These assays remain the gold standard but require specialized facilities for radioactive work.

  • Fluorescence-based methods:

    • FRET/BRET sensors incorporating carA-1 to detect conformational changes upon binding

    • Fluorescently labeled cAMP analogs (MANT-cAMP, Cy3-cAMP) for direct binding measurements

    • Flow cytometry-based binding assays for cell surface expression assessment

  • Surface Plasmon Resonance (SPR):

    • Real-time binding kinetics (kon and koff)

    • No labeling required

    • Requires immobilization of either receptor or ligand

  • Functional downstream assays:

    • G-protein activation measured by [³⁵S]GTPγS binding

    • BRET-based G-protein dissociation assays

    • Calcium flux measurements in engineered reporter cells

Each method has specific advantages depending on the research question. For example, radioligand binding provides the most direct measure of binding affinity but offers limited information about receptor activation, while functional assays demonstrate signaling capability but may be influenced by downstream factors.

How can CRISPR-Cas9 technology be applied to study carA-1 function in Dictyostelium?

CRISPR-Cas9 genome editing has revolutionized functional studies of genes like carA-1 in Dictyostelium by enabling precise genetic manipulations:

  • Gene knockout strategies:

    • Complete gene deletion for loss-of-function studies

    • Conditional knockouts using inducible Cas9 systems

    • Marker-free editing for clean genetic backgrounds

  • Point mutation introduction:

    • Targeted mutation of specific residues to study structure-function relationships

    • Introduction of human disease-related mutations for comparative studies

    • Creation of phosphorylation-mimetic or phosphorylation-deficient variants

  • Tagging approaches:

    • Endogenous tagging with fluorescent proteins for localization studies

    • Introduction of affinity tags for protein complex purification

    • Split-protein complementation tags for protein-protein interaction analysis

  • Regulatory element editing:

    • Promoter modifications to alter expression dynamics

    • UTR editing to study post-transcriptional regulation

    • Enhancer element manipulation

Protocol outline for CRISPR-Cas9 editing of carA-1 in Dictyostelium:

  • Design sgRNAs targeting specific regions of the carA-1 gene

  • Create a repair template containing desired modifications flanked by homology arms

  • Co-transform Dictyostelium cells with Cas9, sgRNA, and repair template

  • Select transformants and verify edits by sequencing

  • Validate phenotypic changes using developmental assays

This technology has significantly accelerated the pace of research by reducing the time needed to generate genetic variants compared to traditional homologous recombination approaches.

What analytical techniques are most informative for studying carA-1-mediated signaling dynamics?

Understanding the complex signaling dynamics downstream of carA-1 activation requires sophisticated analytical approaches:

  • Live-cell imaging techniques:

    • Spinning disk confocal microscopy for real-time visualization of signaling events

    • FRET biosensors for cAMP, PKA activity, and calcium fluctuations

    • Optogenetic tools for spatial and temporal control of carA-1 activation

    • Single-molecule tracking to monitor receptor movement and clustering

  • Phosphoproteomic analysis:

    • Mass spectrometry-based identification of phosphorylation changes

    • Temporal profiling at different stages post-receptor activation

    • Comparison between wild-type and carA- cells to identify specific targets

  • Transcriptomic approaches:

    • RNA-seq to capture global gene expression changes following carA-1 activation

    • Single-cell RNA-seq to identify cell-type specific responses

    • TIME-seq for high temporal resolution of early transcriptional changes

  • Computational modeling:

    • Ordinary differential equation models of carA-1 signaling networks

    • Agent-based models of cell population behaviors

    • Integration of multiple data types for comprehensive pathway reconstruction

An integrated approach combining these methodologies provides the most complete picture of how carA-1 mediates the transition from single-cell to multicellular development. In particular, the combination of live imaging with molecular profiling at defined time points has revealed how carA-1 activation leads to a self-reinforcing signaling circuit that drives developmental commitment and coordinates multicellular behaviors.

How could cryo-EM technology advance structural studies of carA-1 signaling complexes?

The emerging capabilities of cryo-electron microscopy (cryo-EM) offer unprecedented opportunities for structural investigations of carA-1 and its signaling complexes:

  • Advantages of cryo-EM for carA-1 research:

    • No need for crystallization, overcoming a major hurdle in GPCR structural biology

    • Ability to capture multiple conformational states in a single sample

    • Visualization of larger complexes (receptor with G-proteins, arrestins, etc.)

    • Lower protein quantity requirements compared to crystallography

  • Potential research applications:

    • Structure determination of full-length carA-1 in various activation states

    • Visualization of carA-1 oligomers that may form during signaling

    • Structural analysis of carA-1 in complex with Dictyostelium G-proteins

    • Comparison of conformational changes in wild-type vs. mutant receptors

  • Technical considerations:

    • Membrane mimetics (nanodiscs, amphipols) will be crucial for maintaining native-like environment

    • Single-particle analysis may require antibody fragments to increase particle size

    • Time-resolved cryo-EM could potentially capture intermediate states during activation

  • Integration with other methods:

    • Molecular dynamics simulations based on cryo-EM structures

    • Validation of structural insights using site-directed mutagenesis

    • Correlation of structural states with functional outcomes measured by signaling assays

The application of cryo-EM to carA-1 research would bridge a critical knowledge gap between the biochemical understanding of receptor function and the structural basis of its signaling properties, potentially revealing new mechanisms that could be targeted for experimental manipulation.

What insights could comparative studies between carA-1 and mammalian GPCRs provide?

Comparative studies between carA-1 and mammalian GPCRs represent a rich area for investigation with implications extending beyond Dictyostelium biology:

  • Evolutionary insights:

    • Identification of conserved structural elements across ~1 billion years of evolutionary distance

    • Understanding the diversification of GPCR signaling mechanisms

    • Tracing the evolution of ligand specificity in the GPCR superfamily

  • Signaling mechanism comparisons:

    • Differences in G-protein coupling specificity and kinetics

    • Conservation of conformational changes during activation

    • Comparison of regulatory mechanisms (phosphorylation, internalization, desensitization)

  • Translational possibilities:

    • Using carA-1 as a simplified model for understanding complex mammalian GPCR signaling

    • Development of engineered chimeric receptors with novel properties

    • Discovery of new modulatory sites that may exist in mammalian GPCRs

  • Methodological advantages:

    • Testing hypotheses in the genetically tractable Dictyostelium system before moving to more complex mammalian models

    • Ability to perform high-throughput mutational analyses in Dictyostelium that would be challenging in mammalian systems

    • Development of screening platforms for GPCR modulators

The unique position of carA-1 as an evolutionarily distant yet mechanistically similar GPCR makes it an excellent subject for comparative studies that can reveal fundamental principles of receptor biology. The insights gained could inform drug discovery efforts targeting mammalian GPCRs, which represent approximately 34% of all FDA-approved drug targets.

How might synthetic biology approaches utilizing carA-1 advance Dictyostelium as a research model?

Synthetic biology offers exciting possibilities for leveraging carA-1 to develop new research tools and applications:

  • Engineered signaling circuits:

    • Creation of synthetic developmental programs by modifying carA-1 expression and signaling

    • Development of tunable morphogenetic systems for studying collective cell behavior

    • Design of cellular biosensors based on modified carA-1 receptors

  • Optogenetic and chemogenetic tools:

    • Light-activatable carA-1 variants for spatiotemporal control of development

    • Engineered receptors responsive to synthetic ligands

    • Split receptor systems for studying protein-protein interactions in vivo

  • Minimal developmental systems:

    • Defining the minimal genetic components required for carA-1-mediated developmental progression

    • Creation of simplified aggregation systems for biotechnology applications

    • Engineering strain-specific recognition systems based on modified carA-1 signaling

  • Biocomputing applications:

    • Development of cellular computing systems using modified carA-1 signaling networks

    • Creation of pattern-forming cellular systems with programmable properties

    • Design of cellular memory systems based on the developmental commitment properties of carA-1 signaling

These approaches could transform Dictyostelium from a model organism into a versatile synthetic biology platform, while simultaneously providing deeper insights into the molecular mechanisms of development and cellular decision-making. The natural properties of carA-1 in mediating irreversible commitment to development provide an excellent foundation for engineering bistable switches and cellular memory systems with biotechnological applications.

What are the most common issues encountered when working with recombinant carA-1 and how can they be resolved?

Researchers working with recombinant carA-1 frequently encounter several technical challenges:

ChallengePossible CausesSolutions
Low expression levelsToxicity to host cells, poor codon usageUse inducible expression systems, optimize codons for host, lower expression temperature
Inclusion body formationImproper folding, overexpressionCo-express molecular chaperones, use fusion tags (MBP, SUMO), optimize induction conditions
Loss of ligand binding activityDenaturation during purification, incorrect foldingUse milder detergents, include glycerol and stabilizing ligands in buffers
Aggregation during purificationExposure to harsh conditions, detergent removalInclude cholesterol hemisuccinate in buffers, use gradient purification approaches
Heterogeneous glycosylationVariable post-translational modificationsExpress in glycosylation-deficient strains, enzymatically remove glycans post-purification
Poor stability after reconstitutionSuboptimal lipid environmentScreen different lipid compositions, consider nanodiscs or SMALPs instead of detergent
Inconsistent functional assay resultsReceptor degradation, variable activityPerform quality control by SEC before assays, include positive controls, minimize freeze-thaw cycles

Developing a robust workflow for recombinant carA-1 production typically requires systematic optimization of expression conditions, detergent selection, and buffer composition. Maintaining receptor stability throughout purification is often achieved by including a high-affinity ligand during the process, which helps stabilize the native conformation.

How can researchers troubleshoot developmental phenotypes in carA-1 mutant studies?

Investigating developmental phenotypes in carA-1 mutants requires careful experimental design and troubleshooting:

  • Addressing variability in developmental timing:

    • Standardize cell density (precisely 2×10^8 cells/ml for most assays)

    • Control humidity conditions during development

    • Ensure consistent starvation by washing cells thoroughly

    • Use time-lapse imaging to capture the full developmental progression

  • Distinguishing direct from indirect effects:

    • Implement inducible or cell-type specific expression systems

    • Use mosaic analysis with mixed populations of wild-type and mutant cells

    • Perform epistasis analysis with other developmental mutants

    • Employ rescue experiments with timed expression of wild-type carA-1

  • Resolving conflicting phenotypic data:

    • Verify genetic modifications by sequencing

    • Check for secondary mutations or suppressors

    • Ensure proper genetic background by backcrossing

    • Confirm phenotypes in multiple independent clones

  • Addressing technical challenges in assays:

    • For phagocytosis assays, ensure consistent bead concentrations and washing conditions

    • When using bacterial overlay assays, standardize bacterial density (OD600 of 100 per 1×10^7 Dictyostelium cells)

    • For diffusion barrier experiments, verify membrane integrity before interpretation

When analyzing developmental phenotypes, it's important to remember that carA-1 functions within a complex network of signaling pathways. Apparent contradictions in phenotypic data may reflect context-dependent functions or compensatory mechanisms that can be revealed through careful experimental design and systematic troubleshooting.

What controls are essential when studying carA-1-mediated developmental commitment?

Robust experimental design for studying carA-1-mediated developmental commitment requires comprehensive controls:

  • Genetic controls:

    • Wild-type parental strain alongside mutants

    • Multiple independent mutant clones to exclude clone-specific effects

    • Rescue strains expressing wild-type carA-1 to confirm phenotype specificity

    • Additional cAMP signaling mutants (acaA-, gpaB-, yakA-) for pathway validation

  • Developmental time course controls:

    • Regular sampling across development (0, 2, 4, 6, 8, 12, 16, 20, 24h) to capture transitional states

    • Morphological documentation at each time point

    • Molecular markers of developmental progression (gene expression, protein phosphorylation)

  • Commitment assay controls:

    • Positive controls: Known committed-stage cells (e.g., 16h development)

    • Negative controls: Vegetative cells never exposed to starvation

    • Gradient testing: Multiple intermediate time points to identify the commitment threshold

    • Media controls: Testing different nutrient sources (bacterial suspensions, glucose, folic acid, amino acids)

  • Technical methodology controls:

    • For phagocytosis assays: Fixed bead concentration, consistent incubation times (30 minutes), standardized washing conditions (three washes with KK2 containing 20 mM EDTA)

    • For bacterial challenge: Standardized bacterial density (OD600 of 100 per 1×10^7 Dictyostelium cells)

    • For diffusion barrier experiments: Empty dialysis tubing controls, permeability verification

  • Quantification controls:

    • Blind scoring of phenotypes where possible

    • Technical replicates (minimum 3)

    • Biological replicates across different days/cell preparations

    • Statistical analysis appropriate to the experimental design

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.