Recombinant Dictyostelium discoideum Cyclic AMP receptor 4 (carD)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant carD is produced using baculovirus expression systems, ensuring high yields and post-translational modifications akin to native proteins. Key parameters include:

PropertyDetail
Expression SystemBaculovirus-infected insect cells
Purity>85% (verified by SDS-PAGE)
StorageLyophilized form stable for 12 months at -20°C/-80°C
ReconstitutionRecommended in deionized sterile water with 50% glycerol
TagDetermined during manufacturing (e.g., His-tag, GST)

Functional and Developmental Roles

While carD’s specific role is less characterized than cAR1–3, studies on related receptors provide insights:

  • cAMP signaling: CarD likely mediates cAMP-dependent Ca²⁺ influx during multicellular development, similar to cAR1–3 .

  • Developmental regulation: cAR subtypes are sequentially expressed during Dictyostelium’s life cycle, with carD potentially regulating late-stage differentiation .

  • G protein coupling: CarD may activate Ca²⁺ influx independently of Gα subunits, as observed for cAR1–3 .

Research Applications

Recombinant carD enables:

  • Mechanistic studies: Investigating ligand-receptor interactions, phosphorylation dynamics, and downstream signaling .

  • Antibody development: Serving as an antigen for generating recombinant antibodies to study subcellular localization and protein interactions .

  • Comparative analyses: Exploring evolutionary conservation of GPCR signaling between Dictyostelium and metazoans .

Technical Considerations

  • Stability: Repeated freeze-thaw cycles are discouraged; working aliquots stored at 4°C retain activity for one week .

  • Functional assays: Used in calcium flux assays, cAMP binding studies, and structural biology (e.g., cryo-EM) .

Future Directions

Current gaps include carD’s precise role in late development and its cross-talk with other cARs. The availability of recombinant carD facilitates CRISPR-based gene editing and high-throughput screening for signaling modulators .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
carD; car4; DDB_G0277831; Cyclic AMP receptor 4; cAMP receptor 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
carD
Target Protein Sequence
MKVLQEINLTYSILVIADFSSIFGCLLVLIAFKKLKLLRNHITRVIACFCVSSLLKDIIS TGLTLSLGPQNEAGSTSFQCYLYAITITYGSLACWLWTLCLAFSIYNLIVKREPEPEKYE KFYHGVCWTIPLICVIVMLAKKTIEPVGNWCWISEKYVGYRFGLFYGPFFAIWIISAVLV GLTSRYTYSVIRNSVSDNKDKHMTYQFKLINYIIVFLLCWVFAIVNRILNGLGYYPTLPN ILHTYFSVSHGFFASVTFIYNNPLMWRYWGSKIFLIFAKFGYFVELQRRLDRNKNNNNPS PILNSYAATVYHSSTIESLSLQHNNDISNDNQQQQQQQQTPQQPQQQFQQQQSPTVIEMQ NLKQDQNIENNEQNENCYNTIDTNIEINTNKLNDNSFEITQPSNDLNTIENNNNYNNNNN NNNNNSLVIEKEKDEREKKDNKF
Uniprot No.

Target Background

Function

Recombinant Dictyostelium discoideum Cyclic AMP receptor 4 (carD)

This receptor for cAMP regulates axial patterning and cellular differentiation during late development. Its activity is mediated by G proteins.

Database Links
Protein Families
G-protein coupled receptor 5 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of Cyclic AMP Receptor 4 (carD) in Dictyostelium discoideum?

Cyclic AMP receptors in Dictyostelium, including carD, belong to a family of cell surface receptors that play crucial roles in coordinating the aggregation of individual cells into a multicellular organism. These receptors are responsible for regulating the expression of a large number of developmentally regulated genes . While carA-1 (cAMP receptor 1) has been extensively characterized, carD shares structural similarity as part of the cAMP receptor family and likely plays complementary roles in development and signaling processes .

Methodologically, researchers investigating carD function typically employ gene knockout or antisense RNA techniques to observe resulting phenotypes. Studies with carA have shown that cells transformed with vectors expressing antisense mRNA fail to enter the aggregation stage during starvation, demonstrating the essential role of these receptors in development . Similar approaches can be applied to carD to elucidate its specific functions.

How does carD expression change during Dictyostelium discoideum development?

Based on studies of other cAMP receptors in Dictyostelium, carD likely exhibits developmental regulation. For example, the mRNA encoding carA is undetectable in growing cells, rises to maximum levels at 3-4 hours of development, and then declines . Research investigating carD expression patterns would typically employ quantitative RT-PCR or Northern blot analysis at different developmental stages.

To properly analyze developmental expression patterns, researchers should:

  • Synchronize development by starving cells in phosphate buffer

  • Collect samples at regular intervals (0, 2, 4, 8, 12, 16, 20, 24 hours)

  • Extract RNA and perform expression analysis

  • Normalize data to constitutively expressed genes

What are the recommended protocols for expressing recombinant carD in E. coli systems?

Recombinant expression of Dictyostelium proteins, including carD, can be achieved using E. coli expression systems. Based on protocols for carA-1, recombinant carD can be expressed as a full-length protein or in specific functional domains . The standard methodology includes:

  • Cloning the carD sequence into an appropriate expression vector (e.g., with an N-terminal 10xHis tag)

  • Transforming the construct into an E. coli expression strain

  • Inducing expression under optimized conditions

  • Purifying using affinity chromatography

For optimal expression, consider using specialized E. coli strains designed for membrane proteins, as cAMP receptors contain multiple transmembrane domains similar to G protein-coupled receptors .

What is the predicted structure of carD and how does it compare to other cAMP receptors?

Like other cAMP receptors in Dictyostelium, carD is predicted to have a structure similar to G protein-coupled receptors (GPCRs), featuring seven transmembrane domains . The amino acid sequence likely shares similarity with other members of the cAMP receptor family, which have been found to be immunologically cross-reactive with bovine rhodopsin .

A model based on carA suggests that carD would cross the lipid bilayer seven times with a serine-rich cytoplasmic carboxyl terminus, which may be the site of ligand-induced receptor phosphorylation . Researchers can employ various computational tools to predict transmembrane domains and potential phosphorylation sites in carD.

What signaling pathways are activated by carD in Dictyostelium discoideum?

cAMP receptors in Dictyostelium couple to heterotrimeric G proteins, particularly those containing the Gα2 subunit . Activation of these receptors leads to the stimulation of at least three second-messenger pathways:

  • Adenylyl cyclase (AC) - peaking at approximately 90 seconds post-stimulation

  • Guanylyl cyclase (GC) - peaking at approximately 10 seconds

  • Phospholipase C (PLC) - peaking at approximately 7 seconds

The activation of these pathways exhibits adaptation under continuous cAMP stimulation . When investigating carD-specific signaling, researchers should consider using cell lines lacking other cAMP receptors to isolate carD-specific effects.

How can I analyze carD binding affinity and specificity experimentally?

To analyze carD binding characteristics, researchers can utilize radioligand binding assays with purified recombinant carD or with intact cells expressing carD. The general methodology includes:

  • Expressing recombinant carD in appropriate systems

  • Preparing membrane fractions or using intact cells

  • Incubating with radiolabeled cAMP (typically [³H]-cAMP) at various concentrations

  • Measuring bound radioligand after washing to remove unbound material

  • Analyzing data using Scatchard plots or nonlinear regression to determine Kd values

For specificity studies, competition assays using various cAMP analogs can help determine the structural requirements for high-affinity binding to carD specifically.

What methods are most effective for studying carD-mediated chemotaxis in Dictyostelium?

Studying carD-mediated chemotaxis requires specialized assays that can quantify directional cell movement in response to cAMP gradients. Researchers typically employ:

  • Micropipette Assay: A micropipette containing cAMP creates a localized gradient, and cell movement is tracked using time-lapse microscopy.

  • Under-Agarose Assay: Cells are placed in wells cut into agarose, with a separate well containing cAMP. Migration under the agarose toward the chemoattractant is measured.

  • Dunn Chamber: This specialized chamber allows visualization of cells responding to stable gradients.

For quantitative analysis, researchers should track:

  • Directionality (cosine of the angle between movement direction and gradient)

  • Speed (μm/min)

  • Persistence (ratio of net distance to total path length)

  • Chemotactic index (ratio of distance moved in the direction of the gradient to total distance moved)

How do I design experiments to investigate carD phosphorylation patterns during signaling?

cAMP receptors in Dictyostelium undergo ligand-induced phosphorylation, particularly at the serine-rich cytoplasmic carboxyl terminus . To investigate carD phosphorylation:

  • In vivo phosphorylation: Label cells with ³²P-orthophosphate, stimulate with cAMP, immunoprecipitate carD, and analyze by SDS-PAGE and autoradiography.

  • Phosphosite mapping: Use mass spectrometry to identify specific phosphorylated residues.

  • Mutational analysis: Create serine/threonine to alanine mutations at potential phosphorylation sites and assess functional consequences.

  • Phospho-specific antibodies: Develop antibodies that specifically recognize phosphorylated forms of carD.

A typical experimental design would include time-course experiments following cAMP stimulation, with samples collected at 0, 15, 30, 60, 120, and 300 seconds to capture the dynamics of phosphorylation and dephosphorylation.

What are the challenges in developing carD-specific antibodies and how can they be overcome?

Developing specific antibodies against carD presents several challenges:

  • Sequence similarity: carD may share significant sequence homology with other cAMP receptors, making specific epitope selection crucial.

  • Membrane protein nature: The seven transmembrane domains make it difficult to produce properly folded proteins for immunization.

  • Limited availability of reagents: The relatively small Dictyostelium research community means fewer commercial options .

To overcome these challenges, researchers can:

  • Choose unique epitopes from the N-terminal, C-terminal, or loop regions that differ from other cAMP receptors.

  • Use recombinant antibody technologies such as phage display or hybridoma sequencing .

  • Express and purify specific domains rather than the full-length protein.

  • Validate antibody specificity using carD knockout strains or cells overexpressing carD.

The development of recombinant antibody toolboxes for Dictyostelium, as described by researchers , provides useful methodologies that can be applied specifically to carD.

How can I study the role of carD in multicellular development using genetic approaches?

To investigate carD's role in development, several genetic approaches are effective:

  • Gene knockout: CRISPR-Cas9 or homologous recombination can be used to create carD null mutants. Phenotypic analysis should examine aggregation, morphogenesis, and terminal differentiation.

  • Antisense RNA: Similar to studies with carA, expressing antisense RNA against carD can specifically block its expression .

  • Overexpression: Constitutive or inducible overexpression can reveal gain-of-function phenotypes.

  • Domain swapping: Creating chimeric receptors by swapping domains between carD and other cAMP receptors can identify functional regions.

A comprehensive developmental analysis should include:

  • Time-lapse microscopy of developing structures

  • Cell-type specific marker expression

  • Analysis of developmental gene expression patterns

  • Quantification of development timing and efficiency

What experimental approaches can elucidate carD interaction with G proteins?

cAMP receptors in Dictyostelium couple to heterotrimeric G proteins containing Gα2 subunits . To investigate carD-specific G protein interactions:

  • Co-immunoprecipitation: Pull down carD and analyze associated G proteins.

  • FRET/BRET assays: Use fluorescence or bioluminescence resonance energy transfer to detect protein-protein interactions in living cells.

  • GTPγS binding: Measure G protein activation by quantifying binding of non-hydrolyzable GTP analogs in response to carD stimulation.

  • G protein mutants: Analyze carD signaling in cell lines lacking specific G protein subunits.

  • Reconstitution experiments: Express carD and specific G proteins in heterologous systems to detect functional coupling.

These approaches should be conducted under various conditions, including different cAMP concentrations and in the presence of potential regulatory factors.

How does carD differ functionally from other cAMP receptors in Dictyostelium?

While the search results don't specifically address carD's unique functions compared to other cAMP receptors, a methodological approach to determine these differences would include:

  • Expression analysis: Compare temporal and spatial expression patterns of all cAMP receptors using qRT-PCR, in situ hybridization, and reporter constructs.

  • Receptor-specific knockouts: Create single and multiple receptor knockout combinations to identify unique and redundant functions.

  • Binding studies: Compare binding affinities and specificities for cAMP and analogs across receptor subtypes.

  • Signaling assays: Measure activation of various downstream pathways by different receptors.

  • Developmental rescue experiments: Test whether carD expression can rescue phenotypes in cells lacking other cAMP receptors.

This comparative analysis would likely reveal stage-specific roles and signaling pathway preferences that distinguish carD from other family members.

What are the common challenges in purifying recombinant carD and how can they be addressed?

Purifying recombinant cAMP receptors like carD presents several challenges due to their membrane protein nature. Common issues and solutions include:

  • Low expression levels: Optimize codons for E. coli expression and use specialized strains for membrane proteins.

  • Protein misfolding: Express at lower temperatures (16-20°C) and include molecular chaperones.

  • Insolubility: Use appropriate detergents for extraction and purification. A systematic detergent screen should test:

DetergentConcentration RangeTypical RecoveryReceptor Stability
DDM0.5-1%ModerateGood
CHAPS0.5-2%VariableModerate
Triton X-1000.1-1%HighPoor-Moderate
Digitonin0.5-1%LowVery Good
  • Protein aggregation: Include stabilizing agents like glycerol (10-20%) and specific lipids.

  • Loss of activity: Reconstitute into nanodiscs or liposomes to maintain native-like environment.

For carD specifically, researchers should consider using an N-terminal 10xHis tag for purification as described for carA-1 .

How can I optimize transfection efficiency when expressing recombinant carD in Dictyostelium cells?

Achieving efficient transfection for expressing recombinant proteins in Dictyostelium requires optimization of several parameters:

  • Electroporation protocol:

    • Cell density: 1-2 × 10⁷ cells/ml

    • DNA amount: 10-20 μg of plasmid DNA

    • Buffer: H-50 buffer (20 mM HEPES, 50 mM KCl, 10 mM NaCl, 1 mM MgSO₄, 5 mM NaHCO₃, 1 mM NaH₂PO₄)

    • Pulse settings: Two pulses at 0.85 kV, 25 μF

  • Vector selection:

    • For constitutive expression: actin15 promoter

    • For developmental regulation: use appropriate stage-specific promoters

    • Include appropriate Dictyostelium-specific selection markers (G418, Blasticidin, Hygromycin)

  • Cell preparation:

    • Use cells in exponential growth phase

    • Harvest and wash in electroporation buffer

    • Allow 24-hour recovery in rich medium before selection

  • Post-electroporation:

    • Optimize selection antibiotic concentration through kill curves

    • Use clonal selection rather than population selection when possible

For membrane proteins like carD, consider using inducible expression systems to minimize potential toxicity from overexpression.

What quality control measures should be implemented when working with recombinant carD?

When working with recombinant carD, implementing rigorous quality control is essential:

  • Protein purity assessment:

    • SDS-PAGE with Coomassie or silver staining (>90% purity recommended)

    • Western blot using anti-His tag or receptor-specific antibodies

    • Size-exclusion chromatography to assess aggregation state

  • Functional validation:

    • Ligand binding assays using [³H]-cAMP

    • Secondary messenger production in reconstituted systems

    • Conformational analysis via circular dichroism or thermal shift assays

  • Storage stability:

    • Test protein stability at different pH values (6.5-8.0)

    • Evaluate freeze-thaw stability

    • Monitor activity retention during storage at -20°C/-80°C

  • Batch consistency:

    • Implement standard operating procedures for expression and purification

    • Maintain reference standards for comparative analysis

    • Document lot-to-lot variation in yield, purity, and activity

For recombinant carD provided as a lyophilized powder, reconstitution should be performed carefully in appropriate buffer systems, typically Tris/PBS-based buffer with 6% trehalose at pH 8.0, similar to what is recommended for carA-1 .

What statistical approaches are recommended for analyzing carD mutant phenotypes?

When analyzing phenotypes of carD mutants compared to wild-type Dictyostelium, appropriate statistical methods are crucial:

  • For developmental timing studies:

    • Kaplan-Meier survival analysis with log-rank test

    • ANOVA with post-hoc tests for multiple time point comparisons

  • For morphological analyses:

    • Chi-square tests for categorical outcomes

    • Mann-Whitney U test for non-parametric scoring data

  • For chemotaxis parameters:

    • Paired t-tests for before/after comparisons

    • Mixed-effects models for repeated measures over time

  • Sample size determination:

    • Power analysis based on preliminary data

    • Typically n≥30 for developmental assays

    • Minimum n=3 independent biological replicates

  • Dealing with variability:

    • Use standardized growth and development conditions

    • Include positive controls (known mutants) and negative controls (parental strain)

    • Use hierarchical statistical models to account for experiment-to-experiment variation

When reporting results, provide complete statistical information including test used, p-values, confidence intervals, and effect sizes.

How can I resolve contradictory findings when comparing carD functions across different experimental systems?

Contradictory findings regarding carD function may arise from various sources. A systematic approach to resolving such discrepancies includes:

  • Experimental condition analysis:

    • Compare media composition, buffer systems, and cell density

    • Evaluate developmental synchronization methods

    • Assess strain background differences

  • Receptor expression level assessment:

    • Quantify receptor expression in different systems

    • Consider the impact of overexpression versus endogenous levels

    • Evaluate the influence of tags or fusion partners

  • Methodological reconciliation:

    • Direct side-by-side comparison of methods

    • Standardize protocols across laboratories

    • Test for investigator-dependent effects

  • Integrative data analysis:

    • Meta-analysis of multiple studies

    • Weighted evaluation based on methodological robustness

    • Development of unified models that account for context-dependent effects

When publishing, explicitly address contradictions with previous literature and propose specific hypotheses to explain differences.

What are the best practices for analyzing carD phosphorylation data?

Analysis of carD phosphorylation requires rigorous quantitative approaches:

  • Normalization strategies:

    • Normalize phosphorylation signals to total receptor expression

    • Use internal standards for cross-gel comparison

    • Apply appropriate background subtraction methods

  • Kinetic analysis:

    • Fit time-course data to appropriate mathematical models

    • Consider one-phase, two-phase, or more complex phosphorylation/dephosphorylation models

    • Extract rate constants for mechanistic insights

  • Phosphosite occupancy quantification:

    • For mass spectrometry data, compare phosphorylated peptide abundance to non-phosphorylated counterparts

    • Account for ionization efficiency differences

    • Apply label-free or isotope labeling strategies for accurate quantification

  • Visualization approaches:

    • Heat maps for multi-site phosphorylation patterns

    • Radar plots for comparing wild-type versus mutant phosphorylation profiles

    • Network diagrams to illustrate phosphorylation site relationships

  • Functional correlation:

    • Correlate phosphorylation levels with functional outcomes

    • Develop predictive models linking phosphorylation patterns to receptor activity

    • Use principal component analysis to identify key regulatory phosphorylation events

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.