Recombinant Dictyostelium discoideum Cyclic AMP receptor-like protein B (crlB)

Shipped with Ice Packs
In Stock

Description

Introduction to crlB

crlB is a D. discoideum protein belonging to the family of cAMP receptor-like proteins. These receptors regulate key developmental processes, including aggregation, culmination, and spore dormancy, by coordinating cAMP signaling during starvation-induced multicellular development . Recombinant crlB enables researchers to study its biochemical properties and role in cellular communication.

Functional Role in Development

crlB is essential for D. discoideum development:

  • Aggregation: Coordinates cAMP signaling to mediate chemotaxis and cell streaming .

  • Culmination: Required for terminal differentiation into spores and stalk cells .

  • Interaction with PKA: Overexpression of the cAMP-dependent protein kinase catalytic subunit (PKA-C) rescues developmental defects in adenylate cyclase mutants, suggesting crlB functions upstream of PKA activation .

Deletion of crlB results in aggregation-deficient phenotypes, underscoring its non-redundant role in early development .

Key Experimental Insights:

  1. cAMP-Independent Development: Cells lacking all three adenylate cyclases (acaA, acrA, acgA) fail to produce cAMP but still form aggregates when PKA-C is overexpressed, indicating crlB operates independently of cAMP synthesis in later developmental stages .

  2. Allorecognition: crlB mutants exhibit impaired tissue formation and segregation from incompatible wild-type cells, highlighting its role in cell-cell recognition .

  3. Phosphorylation Sites: The cytoplasmic carboxyl terminus of crlB contains serine-rich domains hypothesized to undergo ligand-induced phosphorylation, a mechanism shared with rhodopsin-like GPCRs .

Applications in Research

Recombinant crlB is utilized for:

  • Antibody Production: Generating monoclonal antibodies for protein localization studies .

  • Signal Transduction Studies: Investigating GPCR-mediated pathways in chemotaxis and development .

  • Structural Biology: Analyzing membrane protein folding and ligand-binding dynamics .

Table 2: Functional Phenotypes of crlB Mutants

PhenotypeObservation
Aggregation DeficiencyCells fail to form streams or mounds
Spore Dormancy DefectsAberrant spore maturation in chimeric fruiting bodies
PKA RescuePKA-C overexpression restores near-normal morphology in acaA− mutants

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize the development of the specified tag.
Synonyms
crlB; DDB_G0289395; Cyclic AMP receptor-like protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-442
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
crlB
Target Protein Sequence
MGGDIHLCSMILGKNHLIFLYFANLFGSTLSFLATIITIVFYLVKKYIQNKSFRENPHQY CHQHQYFDSSKLNEINNSGVGSYSSTPISIQNNNNKNNNLPKQKNNEKQPLINKNHNNYC NYSTSATSSSSSSSSFSSTNSGSSYEYQQPQKNQQTLSSSDKNNTIPSTNTKYEIELSIP QFKGNKCGPNCLLFSNIPQIKNALEQKKNPKKIDTLIFYLSISDFIAVSGIIIEQLIIIF NKEISKSIGFCIGERVSIHFGLLATLFWSNCIAYYLLRETYELKPYNIRFVYFHIVCWGM ALIGVASLFFSKIITVSNIDQGGSWCSVSSSYQLYFWVIPLFVSFTWNLICYCLIYRKFN KIIGIYGIQSVQIKTIIIRKLSFYLLAFLITWVWDVINNSIFLYEGKCPPFALWILQEFF SSGYGFFNSLAYAVTTRFYSRK
Uniprot No.

Target Background

Function
Receptor for cAMP.
Database Links
Protein Families
G-protein coupled receptor 5 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Dictyostelium discoideum Cyclic AMP Receptor-like Protein B (crlB) and how does it differ from other cAMP-binding proteins?

Cyclic AMP receptor-like protein B (crlB) is a transmembrane protein expressed in the social amoeba Dictyostelium discoideum with structural similarity to cAMP receptors. Unlike the well-characterized cAMP-binding proteins CABP-1 and CABP-2, which are intracellular proteins involved in mediating cAMP effects, crlB belongs to the family of membrane-bound receptors that likely interact with extracellular cAMP during development . CABP-1 consists of two polypeptides (CABP-1A and CABP-1B) with molecular weights of 41,000 and 36,000 Da respectively, while recombinant crlB is a single polypeptide of 442 amino acids with predicted transmembrane domains . The recombinant form typically contains an N-terminal 10xHis tag to facilitate purification and detection in experimental settings .

What role does crlB play in Dictyostelium discoideum development?

While the specific function of crlB has not been fully elucidated, it likely participates in the cAMP signaling network that governs Dictyostelium's developmental cycle. During starvation, D. discoideum cells secrete, relay, and follow gradients of cAMP, which triggers the transition from single-celled amoebae to multicellular structures . As a cAMP receptor-like protein, crlB potentially responds to extracellular cAMP signals during this developmental program. Research indicates that cAMP receptors are involved in coordination of cell movement, cell adhesion, and gene expression during aggregation and subsequent morphogenesis . To study crlB's specific role, researchers can employ gene knockout studies, expression analysis during different developmental stages, and binding assays to determine its affinity for cAMP and related nucleotides.

What expression systems are used to produce recombinant crlB?

Recombinant crlB is typically produced using bacterial expression systems, with Escherichia coli being the most common host organism . The general methodology involves:

  • Cloning the crlB gene into an appropriate expression vector containing a His-tag coding sequence

  • Transforming the construct into competent E. coli cells

  • Inducing protein expression under optimized conditions (temperature, inducer concentration, duration)

  • Cell lysis and protein extraction

  • Purification using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Further purification steps such as ion exchange or size exclusion chromatography if needed

  • Quality control analysis including SDS-PAGE, Western blotting, and functional assays

The resulting recombinant protein is provided either in liquid form buffered with Tris/PBS-based buffer (pH 8.0) or as a lyophilized powder containing 6% trehalose to enhance stability .

What is the relationship between crlB and other cAMP signaling components in Dictyostelium discoideum?

The cAMP signaling network in D. discoideum is complex and involves multiple components, with crlB potentially playing a specialized role. While cAMP-dependent protein kinase (PKA) has been identified as a major intracellular mediator of cAMP effects, research has revealed additional cAMP-binding proteins such as CABP-1 that suggest alternative signaling pathways . crlB likely functions within this network, possibly mediating responses to extracellular cAMP during development or responding to specific cAMP concentrations or contexts.

The relationship between crlB and other components can be experimentally determined through:

  • Co-immunoprecipitation studies to identify physical interactions

  • Phosphoproteomics to map signaling cascades downstream of crlB

  • Transcriptional analysis in crlB mutants to identify regulated genes

  • Double knockouts with other cAMP signaling components to identify genetic interactions

Understanding these relationships is crucial for building a comprehensive model of cAMP signaling in D. discoideum.

How might post-translational modifications affect crlB function?

Post-translational modifications (PTMs) likely play crucial roles in regulating crlB function. Based on what is known about similar receptors:

  • Phosphorylation: Potential phosphorylation sites in the intracellular domains may regulate receptor desensitization, internalization, and coupling to downstream effectors. Serine/threonine-rich regions in the crlB sequence suggest multiple phosphorylation sites .

  • Glycosylation: N-linked glycosylation sites in the extracellular domains may affect ligand binding, receptor trafficking, and stability.

  • Palmitoylation: Cysteine residues in the C-terminal domain may undergo palmitoylation, affecting membrane localization and signaling properties.

To investigate PTMs experimentally, researchers should consider:

  • Mass spectrometry analysis of purified crlB to identify modifications

  • Site-directed mutagenesis of potential modification sites

  • Pharmacological inhibition of enzymes responsible for specific PTMs

  • Comparison of PTM patterns across different developmental stages

What are the optimal conditions for expressing and purifying recombinant crlB?

Optimizing recombinant crlB expression and purification requires careful consideration of several parameters:

ParameterRecommended ConditionsNotes
Expression hostE. coli BL21(DE3)Alternative strains like Rosetta or Arctic Express may improve folding
VectorpET series with N-terminal His tagpET28a or similar with T7 promoter
Induction0.1-0.5 mM IPTGLower temperatures (16-20°C) may improve solubility
Lysis buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1% Triton X-100, protease inhibitorsOptimization may be required for membrane proteins
PurificationNi-NTA affinity chromatographyConsider detergent screening for membrane proteins
Quality controlSDS-PAGE, Western blot, mass spectrometryVerify protein identity and purity

For membrane proteins like crlB, consider:

  • Using mild detergents during extraction and purification

  • Employing lipid nanodiscs or liposomes for functional studies

  • Testing various expression strategies, including fusion partners to enhance solubility

  • Exploring insect cell or mammalian expression systems if bacterial expression is problematic

These methodological considerations are critical for obtaining high-quality recombinant crlB for subsequent functional and structural studies .

What techniques are most effective for studying crlB binding properties and interactions?

Several complementary techniques can be employed to characterize crlB binding properties and interactions:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified crlB on a sensor chip

    • Flow potential ligands (cAMP, analogs) over the surface

    • Measure real-time binding kinetics (kon, koff) and calculate affinity (KD)

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure thermodynamic parameters of binding

    • No labeling required

    • Provides enthalpy (ΔH), entropy (ΔS), and binding stoichiometry

  • Fluorescence-based assays:

    • Use fluorescent cAMP analogs (e.g., 8-NBD-cAMP)

    • Monitor changes in fluorescence upon binding

    • Suitable for high-throughput screening of binding conditions

  • Radioligand binding assays:

    • Utilize [3H]cAMP or similar radioactive ligands

    • Perform saturation binding to determine Bmax and KD

    • Competition binding to assess ligand specificity

  • Co-immunoprecipitation and pull-down assays:

    • Identify protein-protein interactions

    • Use recombinant antibodies developed specifically for D. discoideum proteins

    • Coupled with mass spectrometry for unbiased interaction screening

Each technique offers distinct advantages, and combining multiple approaches provides the most comprehensive characterization of crlB binding properties.

How can recombinant antibodies be used to study crlB localization and function?

Recombinant antibodies represent valuable tools for studying crlB in D. discoideum. Recent efforts to develop recombinant antibody toolboxes specifically for D. discoideum proteins have expanded the available reagents for the research community . These antibodies can be employed in:

  • Immunofluorescence microscopy:

    • Determine subcellular localization of crlB during different developmental stages

    • Co-localization studies with other signaling components

    • Track changes in distribution upon cAMP stimulation

  • Immunoprecipitation:

    • Isolate crlB and associated proteins from cell lysates

    • Identify novel interaction partners

    • Study complex formation during signaling events

  • Western blotting:

    • Monitor expression levels during development

    • Detect post-translational modifications

    • Verify knockout or knockdown efficiency

  • Functional blocking studies:

    • Use antibodies against extracellular domains to block ligand binding

    • Assess functional consequences on development or signaling

  • Flow cytometry:

    • Quantify surface expression levels in different conditions

    • Sort cells based on expression levels for subsequent analysis

When using recombinant antibodies, researchers should validate specificity using appropriate controls, including knockout strains if available .

How should researchers interpret crlB expression patterns across different developmental stages of Dictyostelium discoideum?

Interpreting crlB expression patterns requires rigorous quantitative analysis and contextual understanding:

  • Temporal expression analysis:

    • Quantify mRNA (RT-qPCR) and protein (Western blot) levels across developmental time points

    • Normalize to appropriate housekeeping genes/proteins

    • Compare with known developmental markers and other cAMP receptor family members

    • Consider using RNA-seq for genome-wide expression context

  • Spatial expression analysis:

    • Use in situ hybridization or immunostaining with recombinant antibodies

    • Determine cell-type specificity within multicellular structures

    • Create expression maps during different morphological stages

  • Statistical considerations:

    • Perform at least three biological replicates

    • Apply appropriate statistical tests for time-course data

    • Consider using clustering algorithms to identify co-regulated genes

  • Interpretation framework:

    • Expression increases may indicate functional importance during specific developmental transitions

    • Correlation with specific morphological events suggests involvement in those processes

    • Co-expression with known pathway components provides functional insights

    • Differential expression in mutant backgrounds can reveal regulatory relationships

Understanding the cAMP signaling context is essential, as D. discoideum uses cAMP both as an extracellular chemoattractant during aggregation and as an intracellular second messenger .

What approaches should be used to analyze potential functional redundancy between crlB and other cAMP receptor-like proteins?

D. discoideum expresses multiple cAMP receptor-like proteins that may exhibit functional redundancy or specialization. Comprehensive analysis of this potential redundancy requires:

  • Systematic genetic analysis:

    • Generate single, double, and multiple knockouts of cAMP receptor genes

    • Quantitatively assess developmental phenotypes, including timing, morphology, and gene expression

    • Create a genetic interaction map using phenotypic severity scores

  • Biochemical comparison:

    • Compare binding affinities and specificities for cAMP and analogs

    • Assess coupling to downstream effectors

    • Identify unique or shared interaction partners

  • Expression complementation:

    • Test whether expression of one receptor can rescue defects caused by knockout of another

    • Use inducible or cell-type specific promoters to control expression timing and location

    • Create chimeric receptors to identify functionally important domains

  • Evolutionary analysis:

    • Compare receptor sequences across related species

    • Identify conserved and divergent features

    • Infer functional importance from evolutionary conservation

A comprehensive data table comparing properties of different cAMP receptors in D. discoideum would serve as a valuable reference:

ReceptorSize (aa)Expression PatternBinding Affinity (Kd)Key Phenotypes of KnockoutUnique Features
crlB442[To be determined][To be determined][To be determined]N-terminal extracellular domain
carA~390Early development~30-300 nMAggregation defectsHigh affinity cAMP binding
carB~370Mid development~μM rangePost-aggregation defectsLower affinity than carA
carC~380Late development[To be determined]Culmination defectsLate expression pattern
carD~360Various stages[To be determined]Subtle defectsBroader expression

This systematic approach allows for a nuanced understanding of the specific roles of crlB within the broader cAMP signaling network in D. discoideum .

How can researchers distinguish between direct and indirect effects when studying crlB function in developmental processes?

Distinguishing direct from indirect effects is a significant challenge when studying developmentally regulated proteins like crlB. Researchers should employ these strategies:

  • Temporal analysis with high resolution:

    • Use rapid induction systems (e.g., tetracycline-inducible expression)

    • Track immediate early responses (seconds to minutes) versus delayed responses

    • Employ live-cell imaging with fluorescent reporters

  • Pharmacological approaches:

    • Use protein synthesis inhibitors (cycloheximide) to block secondary responses requiring new protein synthesis

    • Apply specific inhibitors of downstream pathways to identify branch points

    • Utilize cAMP analogs with different binding specificities

  • Mutational analysis:

    • Create point mutations in specific functional domains rather than complete knockouts

    • Design phosphorylation-deficient or constitutively active mutants

    • Use CRISPR-Cas9 for precise genome editing

  • Single-cell analysis:

    • Employ single-cell RNA-seq to identify cell-type specific responses

    • Use mosaic analysis with cells expressing or lacking crlB

    • Track cell behaviors in chimeric aggregates

  • Mathematical modeling:

    • Develop models incorporating known pathway components

    • Test different network architectures

    • Use parameter fitting to experimental data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.