Recombinant Dictyostelium discoideum Cyclic AMP receptor-like protein C (crlC)

Shipped with Ice Packs
In Stock

Description

Expression and Production

crlC is heterologously expressed in Escherichia coli systems for research applications:

  • Expression Vector: Full-length cDNA cloned into bacterial vectors .

  • Purification: Affinity chromatography via His-tag, yielding >90% purity .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) .

Proteomic studies confirm its detection in Dictyostelium cells during early development, coinciding with cAMP pulsing .

Functional Insights

While crlC’s exact ligand remains unidentified, its homologs (CrlA–CrlC) regulate processes such as:

  • Cell Density Control: CrlA null mutants exhibit hyperproliferation, suggesting Crl family proteins modulate growth .

  • Developmental Signaling: Transcriptomic profiling links crlC to cAMP-dependent pathways governing chemotaxis and cytoskeletal reorganization .

  • Neurological Model Relevance: Dictyostelium GPCRs, including crlC, are studied for homologs to human proteins like LRRK2, implicated in Parkinson’s disease .

Notably, crlC does not bind cAMP directly, distinguishing it from cAR1–4 receptors .

4.1. Mechanistic Studies

  • Chemotaxis Assays: Used to dissect GPCR-mediated signaling in Dictyostelium .

  • Protein Interaction Screens: Phage display and yeast two-hybrid systems identify binding partners .

4.2. Tool Development

  • Antibody Production: Recombinant crlC serves as an antigen for generating monoclonal antibodies .

  • Structural Biology: Crystallization trials to resolve ligand-binding domains .

Key Research Findings

StudyKey ResultSource
Proteomic ProfilingcrlC upregulated during cAMP-pulsed development in AX2 cells
Functional RedundancyCrl receptors compensate for cAR1–4 in chemotaxis-deficient mutants
Neurological ModelingRoco kinase homologs (e.g., GbpC) inform Parkinson’s disease mechanisms

Limitations and Future Directions

Current gaps include:

  • Ligand Identification: No direct evidence links crlC to a specific extracellular signal .

  • In Vivo Role: Knockout studies for crlC are absent in published literature .
    Future work may leverage CRISPR-based editing and live-cell imaging to clarify its role in Dictyostelium development and disease models.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we understand you may have specific requirements. Please indicate your preferred format in your order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on your location and purchase method. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
crlC; DDB_G0283619; Cyclic AMP receptor-like protein C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
crlC
Target Protein Sequence
MGIEESQICNPSDREFLSVDILNIVTSSLSLMGSALTIISYIWKKVRRHRIQKQQIQQQQ QQIEKGGLLSSSITIGNGSSHYGGIGGGGGSGNGTGIGAIGGPHGTYKQPTSKLPLLIFM LSIADFFTSFFIIISQSYLINNSKSYSTPYSPDLKIHFSPCIILRAIIQFFFLSTFFWTT CISYYLFHQLSSPGEEKYLLAIFNVVSWGIPFAISMVITMTNSIVVNSDGWCEVAKPMEL SLWFLPLFLCLLVCSIYYFRLRRLFRSKFEYRLQINDRLKQLDSTISRRLTLYIVVFVIC WLPDVIQHFISFFSKCTFFPLLILQNILTPSQGFWNFWIYSYTNKIARFTPSNDENKRLL Q
Uniprot No.

Target Background

Function
Receptor for cAMP.
Database Links
Protein Families
G-protein coupled receptor 5 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it used as a model organism?

Dictyostelium discoideum is a social amoeba that serves as an excellent model organism for studying various cellular processes. It shares many features with animal cells, making it ideal for investigating basic processes such as cell locomotion, cell adhesion, and phagocytosis . As a haploid organism with a fully sequenced genome, D. discoideum offers significant advantages for genetic manipulation and phenotypic analysis. The conservation of many cellular processes between D. discoideum and higher eukaryotes has established it as a valuable model for investigating cytopathological mechanisms underlying various human disorders, particularly neurological conditions .

What is the function of Cyclic AMP receptor-like protein C (crlC) in Dictyostelium discoideum?

Cyclic AMP receptor-like protein C (crlC) is a transmembrane protein in D. discoideum that belongs to the family of cAMP receptors. This protein plays a role in the detection and transduction of extracellular cAMP signals, which are crucial for the developmental cycle of D. discoideum . The crlC protein contains characteristic domains including transmembrane regions and a cytoplasmic domain involved in signal transduction. The protein's structure, with its 361 amino acids, includes regions associated with membrane localization and signal recognition, contributing to the organism's ability to respond to environmental cues during its life cycle transitions .

How does recombinant crlC differ from native crlC in functional studies?

Recombinant crlC protein is produced through genetic engineering techniques, often incorporating tags that may influence protein folding, stability, or activity compared to the native form. While recombinant proteins offer advantages in purification and detection, researchers should consider potential differences in post-translational modifications between recombinant and native proteins . Experimental validation is necessary to confirm that the recombinant crlC retains the functional properties of the native protein, particularly when using it for binding studies or functional assays. Studies comparing the localization patterns and signaling outcomes between native and recombinant versions can provide critical insights into any functional differences that might impact experimental interpretations.

How can crlC be utilized to study G-protein coupled receptor (GPCR) signaling mechanisms?

The crlC protein shares structural similarities with mammalian GPCRs, making it a valuable model for studying conserved signaling mechanisms. Researchers can engineer specific mutations in the crlC protein to investigate structure-function relationships in GPCR signaling . By combining recombinant crlC expression with genetic manipulations of downstream signaling components in D. discoideum, researchers can dissect complex signaling networks. This approach has particular relevance for understanding ligand binding, receptor activation, and signal transduction mechanisms that are conserved across evolutionary diverse organisms.

What insights can crlC provide into neurological disorder mechanisms?

Despite D. discoideum lacking a nervous system, proteins like crlC share functional homology with receptors implicated in neurological disorders. Researchers utilizing recombinant crlC can investigate fundamental cellular processes disrupted in these conditions . The genetic tractability of D. discoideum allows for the introduction of disease-associated mutations into crlC or its signaling partners to observe resultant phenotypes. This model system has successfully contributed to understanding protein functions related to Alzheimer's disease, Parkinson's disease, and Huntington's disease, demonstrating its utility in neurological research contexts .

What methodological approaches best illuminate crlC interactions with the cytoskeleton during chemotaxis?

Investigating crlC's role in cytoskeletal organization during chemotaxis requires multi-faceted experimental designs. Live-cell imaging combined with fluorescently tagged crlC and cytoskeletal markers provides dynamic spatial and temporal resolution of protein interactions . Researchers can employ super-resolution microscopy techniques to visualize subcellular localization patterns during directed cell movement. Coupling these imaging approaches with genetic manipulations, such as introducing specific mutations in crlC's binding domains, allows for precise dissection of protein-protein interactions governing cytoskeletal rearrangements during chemotaxis.

What expression systems are optimal for producing functional recombinant crlC?

The selection of an appropriate expression system significantly impacts the yield and functionality of recombinant crlC. While bacterial systems offer high protein yields, eukaryotic expression systems like yeast or insect cells better preserve proper protein folding and post-translational modifications essential for crlC functionality . The table below compares key parameters across common expression systems for recombinant crlC production:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, rapid production, cost-effectiveLimited post-translational modifications, potential inclusion body formationStructural studies, antibody production
Yeast (P. pastoris)Proper protein folding, moderate yield, some post-translational modificationsLower yield than bacterial systems, longer production timeFunctional assays, ligand binding studies
Insect cellsProper folding, comprehensive post-translational modificationsHigher cost, complex methodology, lower yieldSignaling studies, interaction analyses
D. discoideumNative cellular environment, authentic modificationsTechnical complexity, specialized expertise requiredIn vivo functional studies, localization experiments

Researchers should select an expression system aligned with their specific experimental objectives, considering factors such as required protein authenticity, yield requirements, and downstream applications .

What purification strategies maintain crlC structural integrity and functionality?

Purification of membrane proteins like crlC requires careful consideration of detergent selection and buffer conditions to maintain native structure. Affinity chromatography utilizing engineered tags provides efficient initial purification, followed by size exclusion chromatography to enhance purity . Critical parameters to monitor during purification include:

  • Detergent concentration: Must be maintained above critical micelle concentration without causing protein denaturation

  • pH stability range: Typically 7.0-8.0 for optimal crlC stability

  • Temperature considerations: Purification at 4°C reduces proteolytic degradation

  • Buffer composition: Inclusion of glycerol (10-20%) enhances protein stability

Functional validation through ligand binding assays or circular dichroism spectroscopy should be performed post-purification to confirm retained structural integrity. The storage conditions, including buffer composition and temperature, significantly impact long-term stability of the purified protein .

How should researchers design experiments to compare wild-type and mutant crlC proteins?

  • Multiple independent clones for each construct to account for clone-specific effects

  • Quantitative assessment of protein expression and membrane localization

  • Controls for potential off-target effects of mutations

  • Dose-response measurements for functional parameters

  • Time-course analyses to capture dynamic responses

Researchers should employ both gain-of-function and loss-of-function approaches when possible, and include rescue experiments to confirm specificity of observed phenotypes. Statistical analysis should account for biological variability and include appropriate tests for significance determination .

How can researchers distinguish between specific crlC-mediated effects and general cellular responses?

Distinguishing specific crlC-mediated effects from general cellular responses requires careful experimental controls and validation strategies. Knockout/knockdown approaches coupled with rescue experiments using wild-type crlC provide strong evidence for specificity . Researchers should implement:

  • Dose-dependency analyses to establish correlation between crlC activity and observed phenotypes

  • Pharmacological inhibitors targeting specific downstream pathways to delineate signaling mechanisms

  • Temporal analyses capturing immediate versus delayed cellular responses

  • Parallel experiments with related receptor proteins to identify unique versus shared signaling outcomes

Advanced approaches include phosphoproteomic analyses to map immediate signaling events following crlC activation, providing a comprehensive view of specific downstream pathways engaged by this receptor .

What are the key considerations when interpreting contradictory data regarding crlC signaling pathways?

When facing contradictory data regarding crlC signaling, researchers should systematically evaluate experimental conditions and model systems. Cell density and developmental stage significantly impact cAMP receptor signaling in D. discoideum and should be standardized across experiments . Important factors to consider include:

  • Differences in genetic backgrounds between D. discoideum strains used

  • Variations in experimental conditions (temperature, media composition, culture age)

  • Technical differences in protein preparation or expression systems

  • Sensitivity and specificity of detection methods employed

  • Temporal dynamics that may reveal transient interactions missed in endpoint assays

Resolving contradictions often requires orthogonal experimental approaches and collaboration between laboratories using standardized protocols. Meta-analysis of existing literature can help identify patterns explaining apparent contradictions in reported findings .

How should data from heterologous crlC expression systems be interpreted relative to native D. discoideum contexts?

Extrapolating findings from heterologous expression systems to native D. discoideum contexts requires careful consideration of system-specific factors. Heterologous systems may lack cofactors or interacting partners present in the native environment . A systematic approach to interpretation should:

Cross-validation using complementary approaches strengthens interpretations, particularly when combining in vitro biochemical data with in vivo functional studies. Researchers should explicitly address potential confounding factors when publishing results from heterologous systems .

What strategies can address poor expression or solubility of recombinant crlC?

Membrane proteins like crlC frequently present expression and solubility challenges that require systematic optimization. Fusion tags can enhance solubility, with maltose-binding protein (MBP) and SUMO tags showing particular efficacy for membrane proteins . Researchers encountering expression difficulties should consider:

  • Codon optimization for the expression host

  • Reducing expression temperature (16-20°C) to allow proper folding

  • Trying different detergents for extraction (DDM, CHAPS, or Fos-choline series)

  • Expressing truncated domains separately if full-length protein proves problematic

  • Adding stabilizing ligands during expression and purification

Solubility screening using different buffer conditions can identify optimal parameters for maintaining protein in solution. For structural studies, protein engineering approaches such as introducing thermostabilizing mutations or removing flexible regions may improve crystallization propensity .

How can researchers troubleshoot inconsistent results in crlC binding assays?

Inconsistent binding assay results often stem from protein quality issues or suboptimal assay conditions. Recombinant crlC should undergo quality control assessment via size exclusion chromatography to confirm monodispersity prior to binding studies . Key troubleshooting steps include:

  • Verifying protein activity immediately after purification

  • Optimizing protein:ligand ratios through titration experiments

  • Testing multiple assay formats (e.g., ELISA, surface plasmon resonance, microscale thermophoresis)

  • Controlling for non-specific binding through appropriate blocking agents and controls

  • Ensuring consistent temperature control throughout experiments

Buffer optimization is critical, as salt concentration and pH significantly impact binding interactions. Preparing fresh protein samples for each experimental series minimizes variability from storage-induced degradation or aggregation .

What approaches can resolve difficulties in detecting protein-protein interactions involving crlC?

Detecting protein-protein interactions with crlC can be challenging due to its transmembrane nature and potential transient interaction dynamics. Proximity labeling approaches (BioID, APEX) provide advantages for capturing transient or weak interactions in their native cellular context . Researchers facing detection difficulties should consider:

  • Cross-linking strategies to stabilize transient interactions prior to isolation

  • Membrane-specific interaction methods such as split-ubiquitin yeast two-hybrid

  • Co-immunoprecipitation using mild detergents optimized for membrane protein complexes

  • Advanced imaging approaches including FRET or BRET to detect interactions in living cells

  • Proteomic approaches with quantitative analysis to distinguish specific from non-specific interactions

Validation through multiple independent methods strengthens confidence in identified interactions. Controls should include known interacting pairs and proteins unlikely to interact with crlC based on cellular localization or function .

How might structural biology approaches enhance our understanding of crlC function?

Advanced structural biology techniques can reveal critical insights into crlC's activation mechanisms and binding interfaces. Cryo-electron microscopy has emerged as particularly valuable for membrane proteins, potentially revealing conformational changes associated with receptor activation . Future structural studies might focus on:

  • Determining high-resolution structures of crlC in different activation states

  • Mapping ligand binding sites through mutagenesis coupled with functional assays

  • Investigating structural dynamics using hydrogen-deuterium exchange mass spectrometry

  • Computational modeling of crlC interactions with downstream effectors

These structural insights would provide a foundation for rational design of crlC mutants to probe specific functional hypotheses and could guide development of tools for manipulating crlC-dependent pathways in D. discoideum .

What emerging technologies might advance research on crlC and related proteins?

Emerging technologies are poised to transform research on crlC and related signaling proteins. CRISPR-based genome editing in D. discoideum enables precise modification of endogenous crlC, creating opportunities for studying receptor function in its native genomic context . Promising technological directions include:

  • Single-cell transcriptomics to map crlC-dependent gene expression changes with unprecedented resolution

  • Optogenetic tools for temporally precise control of crlC activation

  • Advanced imaging modalities including lattice light-sheet microscopy for tracking crlC dynamics in living cells

  • Synthetic biology approaches to engineer novel crlC-based signaling circuits

  • Systems biology integration of multiple data types to model crlC signaling networks

These technologies will enable researchers to address complex questions regarding crlC's role in cellular decision-making processes and may reveal unexpected functions beyond current understanding .

How might findings from crlC research translate to mammalian GPCR biology?

Insights from crlC research have translational potential for understanding mammalian GPCR biology due to conserved structural and functional features. Comparative studies between crlC and mammalian GPCRs can illuminate evolutionary conservation of signaling mechanisms . Promising translational approaches include:

  • Identifying shared regulatory mechanisms and binding partners between crlC and mammalian GPCRs

  • Using D. discoideum as a simplified system to screen for modulators of receptor function

  • Investigating conserved post-translational modifications affecting receptor trafficking and signaling

  • Exploring parallels in receptor desensitization and recycling mechanisms

The simplified cellular background of D. discoideum provides advantages for isolating specific aspects of receptor function that might be obscured in more complex mammalian systems. These comparative approaches may identify fundamental principles of GPCR signaling with relevance to human health and disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.