Recombinant Dictyostelium discoideum Cyclic AMP receptor-like protein F (crlF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crlF; DDB_G0290185; Cyclic AMP receptor-like protein F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
crlF
Target Protein Sequence
MKDIILIYMICAPISMIGSLFIIITWLLYAKLKNSGSNFIFFQAISDFFFTSKYIITIIF YYINIPQFSDETSSTDTNPYCFSLGLFSQFFGQATIMWSYTMTVKVFHSYFEMKKKNNNN NIGSNNIGGGGGGNNSNKQNSIDKTLKWYHLFVWGFCLVNATIIGISKQYGPSSTGCWIV GANNPYRFFELVPLYFTITTSIIILILILVKMKKSKPSSLLPTESMRYNQQAREFKIQLM KFVLIFIIFWLPATVLRTLEYFGIEKTFFILLDAVSVSLQALANSLVWATSPQFLKLMKR KVVNKPNKQMEREYLINK
Uniprot No.

Target Background

Function
Receptor for cAMP.
Database Links
Protein Families
G-protein coupled receptor 5 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What makes Dictyostelium discoideum an advantageous model for studying cAMP receptors?

Dictyostelium discoideum offers several distinct advantages as a model system for studying cAMP receptors and related proteins:

  • The fully sequenced, low redundancy genome provides a less complex system while maintaining many genes and signaling pathways found in more complex eukaryotes

  • Its haploid genome allows researchers to introduce single or multiple gene disruptions with relative ease

  • The 24-hour multicellular developmental cycle permits rapid detection of developmental phenotypes

  • Numerous expression constructs are available for studying protein localization and function

  • Insertional mutant libraries facilitate pharmacogenetic screens that enhance understanding of bioactive compounds at the cellular level

The genetic tractability of D. discoideum, combined with its unique life cycle, makes it particularly valuable for studying the functions of cAMP receptors and their role in development and cellular signaling.

What is the known functional significance of cAMP receptors in Dictyostelium development?

During the early stages of its developmental program, Dictyostelium discoideum expresses cell surface cyclic AMP receptors that serve critical functions:

  • They coordinate the aggregation of individual cells into a multicellular organism

  • They regulate the expression of numerous developmentally regulated genes

  • They function as chemotactic sensors during the aggregation phase, allowing cells to move toward sources of cAMP

  • They help establish differential cell fates during development, contributing to pattern formation in the multicellular structure

The cAMP receptors essentially control development in Dictyostelium, translating environmental signals into coordinated cellular responses that drive the transition from unicellular to multicellular stages.

How do the structural and functional domains of crlF compare with other cAMP receptor family members?

While specific structural information about crlF is limited in the provided sources, comparative analysis with other cAMP receptor family members would typically include:

Domain FeatureTypical cAMP ReceptorHypothesized crlF StructureMethodological Approach
Transmembrane domains7 TM domains (GPCR-like)Likely 7 TM domainsHydropathy analysis, structural prediction
cAMP binding pocketConserved residues in extracellular loopsMay have modified binding residuesSite-directed mutagenesis, ligand binding assays
G-protein couplingSpecific intracellular loop motifsMay have unique coupling specificityCo-immunoprecipitation, BRET/FRET analysis
Phosphorylation sitesMultiple Ser/Thr in C-terminusMay contain regulatory phosphorylation sitesMass spectrometry, phospho-specific antibodies

To determine the specific structural characteristics of crlF, researchers should employ a combination of:

  • Sequence alignment with known cAMP receptors

  • Prediction of transmembrane regions and functional domains

  • Experimental validation using tagged recombinant proteins

  • Site-directed mutagenesis to identify critical functional residues

What signaling pathways might crlF regulate in Dictyostelium development?

Based on known functions of cAMP receptors in Dictyostelium, crlF may regulate several signaling pathways:

  • G-protein coupled pathways leading to adenylyl cyclase activation and cAMP production

  • Phosphoinositide signaling, potentially similar to the PIP2-dependent processes described by Janetopoulos and Fadil for migrating Dictyostelium amoebae

  • Cytoskeletal regulation pathways, particularly those involved in chemotactic movement

  • Transcriptional regulation of developmental genes

Research methodologies to elucidate crlF-specific pathways would include:

  • Generating crlF knockout strains and analyzing their phenotypes

  • Using phosphoproteomic approaches to identify downstream targets

  • Employing transcriptomics to identify genes regulated by crlF

  • Creating chimeric receptors to identify domain-specific functions

What are the optimal methods for expressing recombinant crlF in Dictyostelium?

For successful expression of recombinant crlF, researchers should consider these methodological approaches:

  • Vector selection: Utilize expression vectors optimized for Dictyostelium, such as those described by Levi et al. (2000), Veltman et al. (2009), and Müller-Taubenberger and Ishikawa-Ankerhold (2013)

  • Promoter choice:

    • Constitutive promoters (actin15) for consistent expression

    • Inducible promoters for temporal control of expression

    • Native crlF promoter for physiological expression patterns

  • Protein tagging strategies:

    • C-terminal tags if N-terminus is involved in signaling

    • N-terminal tags if C-terminus contains regulatory elements

    • Internal tags if both termini are functionally important

    • Fluorescent protein fusions (GFP, RFP) for localization studies

    • Affinity tags (His, FLAG, HA) for purification and detection

  • Expression validation methods:

    • Western blotting to confirm protein size and expression level

    • Fluorescence microscopy to verify localization if using fluorescent tags

    • Functional assays to ensure proper protein activity

Importantly, researchers should test whether the recombinant crlF can rescue phenotypes in crlF-null mutants to validate its functionality.

How can gene disruption techniques be effectively applied to study crlF function?

The haploid nature of Dictyostelium makes it particularly amenable to gene disruption techniques . For crlF functional studies, consider these approaches:

  • Homologous recombination:

    • Design constructs with selectable markers flanked by crlF homology regions

    • Screen transformants for successful integration and gene disruption

    • Confirm disruption by PCR, Southern blotting, and RT-PCR

  • CRISPR-Cas9 gene editing:

    • Design guide RNAs targeting the crlF coding sequence

    • Include a repair template to introduce specific mutations or tags

    • Screen for successful editing by sequencing

  • Conditional expression systems:

    • Tetracycline-inducible or repressible systems

    • Temperature-sensitive mutants for temporal control

    • Tissue-specific promoters for spatial control

  • Validation strategies:

    • Phenotypic analysis at different developmental stages

    • Rescue experiments with wild-type crlF

    • Complementation tests with other cAMP receptor mutants

When analyzing gene disruption phenotypes, researchers should examine:

  • Development timing and morphology

  • Chemotactic responses to cAMP gradients

  • Cell-cell signaling during aggregation

  • Expression of developmentally regulated genes

What imaging techniques can best reveal crlF localization and dynamics in living cells?

For comprehensive analysis of crlF localization and dynamics, researchers should employ these imaging approaches:

Imaging TechniqueApplication for crlF ResearchMethodological Considerations
Confocal microscopyBasic subcellular localizationUse GFP-tagged crlF; compare with other cellular markers
TIRF microscopyMembrane dynamics and clusteringRequires cells adherent to glass; reveals surface receptor behavior
FRAP analysisReceptor mobility and turnoverPhotobleach a region and measure recovery kinetics
Super-resolutionNanoscale organization of receptorsTechniques like PALM/STORM provide 20-50nm resolution
Live cell imagingDynamic responses to cAMP stimulationRequires stable expression and non-phototoxic imaging
Correlative light-EMUltrastructural context of localizationCombines fluorescence with electron microscopy detail

Processing and analysis considerations:

  • Use appropriate controls for autofluorescence and non-specific binding

  • Apply deconvolution algorithms to improve signal-to-noise ratio

  • Perform quantitative analysis of receptor distribution and clustering

  • Track receptor movements in response to stimuli over time

How should researchers interpret complex phenotypes in crlF mutant strains?

Interpreting phenotypes of crlF mutants requires a systematic approach:

  • Developmental analysis:

    • Document timing of developmental landmarks (aggregation, mound formation, slug migration, culmination)

    • Quantify morphological parameters of structures at each stage

    • Compare cell-type proportional composition in final fruiting bodies

  • Cell behavior analysis:

    • Measure chemotactic efficiency using micropipette assays or microfluidic devices

    • Analyze cell speed, directionality, and persistence in cAMP gradients

    • Evaluate cell-cell adhesion and signal relay capabilities

  • Molecular analysis:

    • Assess expression patterns of developmental markers

    • Measure cAMP production and response to external cAMP

    • Analyze activation of downstream signaling pathways

  • Comparative analysis:

    • Compare with phenotypes of other cAMP receptor mutants

    • Construct double mutants to test genetic interactions

    • Perform cross-species complementation with mammalian homologs

Critically, researchers should distinguish between direct effects of crlF mutation and secondary consequences due to altered developmental progression by using appropriate temporal controls and stage-matched comparisons.

What statistical approaches are most appropriate for analyzing cAMP receptor signaling data?

When analyzing cAMP receptor signaling data from Dictyostelium experiments, consider these statistical approaches:

  • For chemotaxis experiments:

    • Use directional statistics (e.g., circular variance) to analyze cell movement vectors

    • Apply mixed-effects models for cell tracking data to account for cell-to-cell variability

    • Employ Kolmogorov-Smirnov tests to compare distributions of chemotactic indices

  • For developmental timing experiments:

    • Apply survival analysis techniques to developmental milestone achievement

    • Use repeated measures ANOVA for time-course data

    • Implement bootstrapping methods for non-parametric comparisons

  • For gene expression studies:

    • Use appropriate multiple testing corrections for transcriptome-wide analyses

    • Apply principal component analysis to identify major patterns in expression data

    • Implement time-series analysis for developmental gene expression profiles

  • For imaging data:

    • Use spatial statistics to analyze receptor clustering

    • Apply image correlation techniques to measure co-localization

    • Implement Bayesian methods for single-molecule tracking analysis

Sample size determination should account for the high variability often observed in Dictyostelium experiments, with power analyses conducted to ensure adequate statistical power.

How can studies of crlF and related receptors in Dictyostelium inform research on neurological disorders?

Dictyostelium has emerged as an excellent model system for studying proteins linked to human neurological disorders . Studies of crlF can contribute to neurological research in several ways:

  • Functional conservation: Biological pathways regulating protein function are likely conserved from Dictyostelium to humans , making discoveries about crlF potentially relevant to human receptor biology.

  • Disease model applications: Dictyostelium has been successfully used to study several neurological disorders:

    • Alzheimer's disease mechanisms, particularly related to γ-secretase complex function

    • Parkinson's disease pathways

    • Huntington's disease processes

    • Neuronal ceroid lipofuscinoses (Batten disease), with Dictyostelium encoding homologs of 11 of the 13 known genes linked to NCL

    • Lissencephaly pathophysiology

  • Experimental advantages:

    • The ability of human proteins to rescue gene-deficiency phenotypes in Dictyostelium suggests conserved functionality

    • Dictyostelium's genetic tractability facilitates rapid hypothesis testing about protein function

    • The organism's simple developmental system allows for clear assessment of phenotypic outcomes

  • Drug development applications:

    • Insertional mutant libraries facilitate pharmacogenetic screens that have enhanced understanding of bioactive compounds

    • Dictyostelium can serve as an initial screening system for compounds targeting conserved pathways

What methodologies can be used to translate findings from crlF studies to mammalian systems?

To effectively translate discoveries about crlF from Dictyostelium to mammalian systems, researchers should consider these methodological approaches:

  • Sequence homology analysis:

    • Identify mammalian proteins with sequence similarity to crlF

    • Focus on conserved functional domains and motifs

    • Use phylogenetic analysis to establish evolutionary relationships

  • Complementation studies:

    • Express mammalian homologs in crlF-null Dictyostelium and assess rescue

    • Create chimeric receptors with domains from mammalian proteins

    • Express Dictyostelium crlF in mammalian cell lines lacking related receptors

  • Parallel pathway analysis:

    • Compare signaling pathways downstream of crlF with those of related mammalian receptors

    • Identify conserved binding partners and effectors

    • Test whether pharmaceutical agents affecting crlF function also affect mammalian homologs

  • Structure-function correlation:

    • Use insights from crlF structure to predict functional domains in mammalian homologs

    • Target critical residues identified in Dictyostelium for mutagenesis in mammalian proteins

    • Apply molecular modeling to compare ligand binding pockets

  • Disease-relevant phenotypic assays:

    • Develop Dictyostelium-based assays that model aspects of neurological diseases

    • Use these assays to screen for compounds that may have therapeutic potential

    • Validate findings in mammalian cell culture and animal models

What emerging technologies could advance our understanding of crlF biology?

Cutting-edge technologies that could significantly advance crlF research include:

  • Advanced genome editing:

    • Prime editing for precise nucleotide changes without double-strand breaks

    • Base editing for targeted C→T or A→G conversions

    • Large-scale CRISPR screens to identify genetic interactions with crlF

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell-type specific effects of crlF signaling

    • Single-cell proteomics to analyze protein level changes

    • Spatial transcriptomics to map gene expression changes during development

  • Advanced imaging:

    • Lattice light-sheet microscopy for long-term 3D imaging with minimal phototoxicity

    • Cryo-electron microscopy for high-resolution structural analysis

    • Expansion microscopy for super-resolution imaging of protein complexes

    • Biosensors to visualize cAMP dynamics and downstream signaling events

  • Structural biology:

    • AlphaFold2 or similar AI-based structure prediction of crlF

    • Hydrogen-deuterium exchange mass spectrometry to map ligand binding sites

    • Native mass spectrometry to analyze receptor complexes

  • Systems biology approaches:

    • Multi-omics integration to build comprehensive models of crlF signaling

    • Network analysis to position crlF within developmental regulatory networks

    • Machine learning to predict phenotypic outcomes of receptor variants

Researchers should consider how these technologies can be adapted to the unique properties of Dictyostelium while maintaining their analytical power.

What are the most pressing unanswered questions about crlF that should be addressed?

The most critical unanswered questions about crlF that merit investigation include:

  • Structural determinants of function:

    • What structural features distinguish crlF from other cAMP receptor family members?

    • How does ligand binding induce conformational changes in crlF?

    • What post-translational modifications regulate crlF activity?

  • Developmental roles:

    • At which developmental stages is crlF expression critical?

    • Does crlF play specialized roles in specific cell types during development?

    • How does crlF function cooperate with or differ from other cAMP receptors?

  • Signaling specificity:

    • What G-protein subtypes couple specifically to crlF?

    • What unique downstream effectors are activated by crlF?

    • How is signal specificity maintained when multiple cAMP receptors are present?

  • Evolutionary perspectives:

    • How conserved is crlF structure and function across different Dictyostelid species?

    • What can evolutionary analysis tell us about the specialization of crlF function?

    • Are there functional homologs in higher organisms that have evolved from common ancestors?

  • Therapeutic potential:

    • Can insights from crlF biology inform drug development for diseases involving related receptors?

    • Are there natural or synthetic compounds that specifically modulate crlF function?

    • Could crlF-based assays serve as screening platforms for neurological disease therapeutics?

Addressing these questions will require interdisciplinary approaches combining molecular biology, structural biology, systems biology, and evolutionary analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.