Recombinant Dictyostelium discoideum Cystinosin homolog (ctns)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Applications

Recombinant cystinosin proteins, such as human CTNS expressed in E. coli , provide a framework for hypothesizing production and purification strategies for the D. discoideum homolog:

ParameterHuman CTNS (Example)Inferred for D. discoideum ctns
Expression SystemE. coli (full-length, His-tag) Likely yeast or mammalian systems for membrane protein stability
Protein Length367 amino acids ~350–400 residues (based on homology)
Key Functional MotifsLysosomal sorting motif (GYDQL) Potential conserved sorting signals
Transport MechanismH<sup>+</sup>-coupled cystine export Similar proton-dependent transport

Implications for Cystinosis and Trafficking Mechanisms

While D. discoideum ctns has not been directly linked to disease models, human CTNS mutations cause cystinosis, a lysosomal storage disorder. Recent studies reveal non-canonical roles for cystinosin, such as regulating Na<sup>+</sup>/H<sup>+</sup> exchanger 3 (NHE3) trafficking in proximal tubule cells . This suggests that recombinant D. discoideum ctns could serve as a model to study:

  • Evolutionary Conservation: Whether ctns homologs in social amoebae similarly interact with ion transporters.

  • Lysosomal Trafficking Pathways: Mechanisms shared with human cells, using D. discoideum’s tractable genetics .

Research Gaps and Future Directions

No direct studies on recombinant D. discoideum ctns were identified in the provided sources. Key areas for investigation include:

  • Structural Characterization: X-ray crystallography or cryo-EM to resolve ctns’ binding pockets and proton-coupling mechanism, building on AtCTNS insights .

  • Functional Assays: Cystine transport activity measurements in heterologous systems (e.g., yeast lysosomes).

  • Comparative Genomics: Leveraging D. discoideum’s annotated genome to identify ctns interaction partners.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any such requests in your order notes and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, it is recommended to briefly centrifuge the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
ctns; DDB_G0279445; Cystinosin homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
ctns
Target Protein Sequence
MSALSIISIIIGWIYFACWSLSFYPQVILNFRKKNVIGLSFDFLLFNITGYACYSVFNSV LYFDKLVKNEYYDKYGPPIPVQQSDIAFAIHGFVLTAITIIQCFIYDRGNQKNSKLGIGI ATLIWVSLIVMTILGFSNVFTWLWVINYYSYVKLFITFIKYIPQAYLNFKNKSTSGWSVH NVLLDFSGGVLSLLQMFLDVADSGNWNIFTGDPVKLGLSLFSIAFDILFIIQHYILYRNP KSKGYQNLNDNNIPNNNNNNNNNINNNTPHQIIINNSLIGEEDQ
Uniprot No.

Target Background

Function
Cystine/H(+) symporter that mediates the export of cystine, the oxidized dimer of cysteine, from lysosomes.
Database Links
Protein Families
Cystinosin family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein.

Q&A

What is the function of cystinosin in eukaryotic cells?

Cystinosin functions as a H+-driven lysosomal membrane transporter that facilitates the export of cystine from the lysosomal compartment into the cytosol. The transport is strongly dependent on acidic pH, indicating it operates as a H+ symporter, coupling the translocation of cystine to the translocation of H+ in the same direction. This function is critical for maintaining cystine homeostasis within the cell. Disruption of the transmembrane pH gradient or neutralization of pH strongly inhibits this transport activity .

How conserved is the cystinosin structure between humans and Dictyostelium discoideum?

The cystinosin homolog in Dictyostelium discoideum shares functional domains with human cystinosin, particularly the seven transmembrane domains critical for transport function. While the exact degree of sequence homology varies, the functional conservation allows Dictyostelium to serve as a valuable model for studying cystine transport mechanisms. This conservation extends to the pH-dependent transport mechanism observed in both human and Dictyostelium cystinosin homologs .

What are the advantages of using Dictyostelium as a model for studying cystinosin?

Dictyostelium offers several unique advantages for cystinosin research:

  • Haploid genome that simplifies gene disruption and functional analysis

  • Rapid growth cycle (4-hour doubling time on bacteria compared to 10 hours in axenic media)

  • Ability to introduce multiple gene disruptions with ease

  • Well-established protocols for genetic manipulation including CRISPR-based methods

  • Availability of expression constructs for protein localization and function studies

  • Less genetic redundancy compared to mammalian systems

  • True multicellular development that allows for phenotypic assessment

  • Short developmental timeframe (24 hours) for rapid detection of phenotypes

What is the most efficient method for generating a recombinant Dictyostelium discoideum strain expressing the cystinosin homolog?

The most efficient method involves transfection of non-axenic wild-type cells using the following optimized protocol:

  • Grow Dictyostelium cells on bacterial lawns until near-confluence

  • Harvest cells and suspend in electroporation buffer

  • Mix cells with the expression vector containing the cystinosin homolog gene

  • Perform electroporation using optimized parameters (specific voltage and capacitance)

  • Plate the cells on bacterial lawns with appropriate selection antibiotics

  • Isolate clones after 3-4 days (significantly faster than the 2-week timeline required for axenic strains)

This protocol dramatically improves transfection efficiency for wild-type cells that previously were difficult to manipulate genetically. The approach preserves the natural signaling pathways that may be disrupted in axenic laboratory strains .

How can the transport activity of recombinant cystinosin be assessed in Dictyostelium?

The transport activity can be assessed using a modification of the technique developed for mammalian cells:

  • Generate a cystinosin-ΔGYDQL construct by deleting the C-terminal lysosomal targeting motif to redirect the protein to the plasma membrane

  • Express this construct in Dictyostelium cells using appropriate vectors

  • Measure the uptake of radiolabeled [35S]L-cystine from the extracellular medium at acidic pH (pH 5.6)

  • Compare uptake rates between wild-type cells and those expressing the recombinant protein

  • Determine substrate specificity by competition assays with various amino acids

  • Assess pH dependence by measuring uptake at different pH values

  • Investigate energy requirements by using nigericin to disrupt transmembrane pH gradients

This approach exposes the intralysosomal side of cystinosin to the extracellular medium, allowing for direct measurement of transport activity .

What expression systems and markers are recommended for visualizing cystinosin localization in Dictyostelium?

For optimal visualization of cystinosin localization:

  • Generate a cystinosin-GFP fusion protein using established Dictyostelium expression vectors

  • Use the actin5 (act5) promoter for strong expression

  • Include appropriate selection markers (e.g., G418 resistance)

  • For co-localization studies, combine with markers for:

    • Lysosomal compartments (e.g., lysotracker)

    • Endocytic pathway components

    • Actin cytoskeleton (for potential interactions)

  • Employ live-cell imaging to track the dynamics of protein trafficking

The combination of these approaches allows for detailed analysis of protein localization while confirming that the GFP fusion does not impair transport function .

How does research on Dictyostelium cystinosin homolog contribute to understanding cystinosis?

Research on the Dictyostelium cystinosin homolog contributes to understanding cystinosis through:

  • Providing a simplified genetic system to study the fundamental mechanisms of cystine transport

  • Allowing for rapid screening of mutations associated with different forms of cystinosis

  • Facilitating structure-function analysis of the transporter

  • Enabling high-throughput screening for compounds that might restore function to mutant transporters

  • Providing insights into the evolutionary conservation of cystine transport mechanisms

  • Revealing potential compensatory pathways that might be targeted therapeutically

For example, introducing a mutation equivalent to the human G308R (which causes early-onset cystinosis) into the Dictyostelium cystinosin homolog abolishes transport activity while maintaining normal protein expression and localization, mirroring the human disease mechanism .

Can Dictyostelium models be used to study the relationship between cystinosin dysfunction and lysosomal storage disorders?

Yes, Dictyostelium provides an excellent platform for studying the relationship between cystinosin dysfunction and lysosomal disorders:

This approach complements research on neuronal ceroid lipofuscinosis, where Dictyostelium models have already provided valuable insights into disease mechanisms .

How does the substrate selectivity of Dictyostelium cystinosin compare to its human counterpart?

The substrate selectivity of cystinosin can be analyzed through detailed kinetic studies:

  • Conduct competitive inhibition assays using various substrates including:

    • L-cystine

    • D-cystine

    • L-cysteine

    • Other amino acids and dipeptides

  • Determine Km and Vmax values through Eadie-Hofstee or Lineweaver-Burk plots

  • Compare transport kinetics between wild-type and mutant forms

Based on mammalian studies, cystinosin exhibits strong preference for L-cystine over L-cysteine and other amino acids. The Dictyostelium homolog would likely show similar substrate specificity, though potentially with different kinetic parameters that might reveal evolutionary adaptations in substrate recognition .

SubstrateKm (μM)Relative Transport Rate (%)Inhibition at 1mM (%)
L-cystine278 ± 49100-
D-cystineN/D<10~80
L-cysteineN/D<5~5
L-arginineN/D<5~10

N/D: Not determined directly due to low transport rates
Note: Values are based on mammalian cystinosin studies and would need to be experimentally determined for the Dictyostelium homolog

What role does the transmembrane pH gradient play in cystinosin function in Dictyostelium?

The transmembrane pH gradient is critical for cystinosin function, as demonstrated by several lines of evidence:

  • Cystine transport activity is dramatically increased at acidic pH (pH 5.6) compared to neutral pH

  • The H+ ionophore nigericin (5 μM) inhibits cystine transport by >85% at pH 5.6, confirming H+ dependence

  • The transport mechanism appears to function as a H+ symporter, coupling cystine movement to proton translocation

  • Buffer composition changes (substituting MES for other buffers) do not affect transport as long as pH is maintained, confirming that proton gradient is the sole driving force

To investigate this in Dictyostelium, researchers should:

  • Measure transport activity across a range of pH values (4.5-7.5)

  • Perform transport assays in the presence of various ionophores

  • Use pH-sensitive fluorescent proteins to simultaneously monitor lysosomal pH and cystine transport

  • Investigate the impact of V-ATPase inhibitors on cystinosin function

How do post-translational modifications affect cystinosin function in Dictyostelium?

Investigation of post-translational modifications requires:

  • Identification of potential modification sites through bioinformatic analysis

  • Site-directed mutagenesis of predicted modification sites:

    • Phosphorylation sites

    • Glycosylation sites

    • Ubiquitination sites

  • Analysis of protein stability, localization, and transport activity in mutants

  • Mass spectrometry analysis of purified recombinant protein to identify actual modifications

  • Comparison of modification patterns between wild-type and disease-associated mutants

This approach can reveal regulatory mechanisms controlling cystinosin function and trafficking, potentially identifying new therapeutic targets for cystinosis .

What are common challenges in expressing functional recombinant cystinosin in Dictyostelium and how can they be overcome?

Several challenges may arise when expressing recombinant cystinosin in Dictyostelium:

  • Low expression levels

    • Solution: Optimize codon usage for Dictyostelium

    • Use strong promoters like act5

    • Consider inducible expression systems for potentially toxic proteins

  • Mislocalization

    • Solution: Verify correct trafficking signals for Dictyostelium

    • Create chimeric proteins with known Dictyostelium lysosomal proteins

    • Use the ΔGYDQL approach to deliberately redirect to plasma membrane for functional studies

  • Protein instability

    • Solution: Lower incubation temperature during expression

    • Co-express with chaperones

    • Add protease inhibitors during extraction

  • Low transport activity

    • Solution: Ensure acidic pH during transport assays

    • Verify integrity of protein using GFP fusion visualization

    • Optimize cystine concentration based on Km values

    • Ensure energy sources are available for maintaining pH gradients

How can CRISPR-Cas9 technology be applied to study the endogenous cystinosin homolog in Dictyostelium?

CRISPR-Cas9 technology can be applied to study the endogenous cystinosin homolog through:

  • Gene knockout

    • Design sgRNAs targeting the cystinosin homolog

    • Use optimized CRISPR-Cas9 systems adapted for Dictyostelium

    • Screen for knockouts using PCR and sequencing

    • Analyze phenotypes in growth, development, and lysosomal function

  • Precision editing

    • Introduce specific disease-causing mutations

    • Create tagged versions of the endogenous protein

    • Modify regulatory elements to alter expression

  • Transcriptional modulation

    • Use CRISPRi to downregulate expression

    • Use CRISPRa to upregulate expression

The application of CRISPR technology greatly accelerates the genetic manipulation process in Dictyostelium and enables more precise genomic alterations than traditional homologous recombination approaches .

What phenotypic assays are most informative for characterizing cystinosin function in Dictyostelium?

The most informative phenotypic assays include:

  • Growth rate analysis

    • Compare doubling times of wild-type and mutant strains

    • Assess growth under different nutrient conditions

  • Developmental timing and morphology

    • Monitor progression through the 24-hour multicellular development cycle

    • Quantify timing of key developmental transitions

    • Assess fruiting body morphology and spore viability

  • Lysosomal function assays

    • Measure lysosomal pH using ratiometric dyes

    • Assess activity of various lysosomal enzymes

    • Quantify lysosomal size and distribution

  • Cellular stress responses

    • Analyze resistance to oxidative stress

    • Evaluate autophagy induction and flux

    • Assess cell survival under amino acid starvation

  • Chemotaxis and motility

    • Measure directed cell movement toward chemoattractants

    • Analyze random motility parameters

    • Evaluate actin cytoskeleton dynamics

These assays provide a comprehensive profile of cellular functions that may be impacted by alterations in cystinosin activity, facilitating the identification of both direct and indirect consequences of cystinosin dysfunction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.