Recombinant Dictyostelium discoideum Cytochrome c oxidase subunit 3 (cox3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Respiration

Cox3 is essential for the structural integrity and catalytic activity of cytochrome c oxidase (Complex IV). It facilitates proton translocation across the mitochondrial inner membrane, enabling ATP synthesis. In D. discoideum, Cox3 is part of a mitochondrial proteome compendium of 936 proteins, underscoring its evolutionary conservation in bioenergetics .

Biochemical Studies

  • SDS-PAGE Analysis: Used to assess purity and molecular weight .

  • Enzyme Activity Assays: Functional studies of electron transport chain dynamics .

Model for Mitochondrial Disorders

D. discoideum is a tractable system for studying mitochondrial genetics due to its transparent multicellular structures and conserved respiratory machinery. Recombinant Cox3 enables:

  • Mechanistic insights into oxidative phosphorylation defects.

  • Comparative studies with human homologs implicated in diseases like Leigh syndrome .

Evolutionary Conservation

Cox3 in D. discoideum shares functional homology with human mitochondrial proteins, making it a proxy for studying respiratory chain evolution. Its role in proton pumping is conserved across eukaryotes .

Proteomic Relevance

A mitochondrial proteome study identified Cox3 as part of a core set of 616 proteins with human orthologs, highlighting its utility in cross-species comparisons .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve Cox3’s role in Complex IV assembly.

  • Disease Modeling: Linking Cox3 dysfunction to mitochondrial pathologies using D. discoideum mutants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
cox3; DDB_G0294092; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
cox3
Target Protein Sequence
MKGFFENLFRQNVRSVINTGKKVGARAAAREIINQEWGYPLANHEVLFLTNVYQPKHMKR HPFHIVRGTVAPLAVTLPLGFFVLNYFGVISSKLGLLIALSSFIGGLVIWTISIIFDSLY DQQHTYEVKRGLVMGMMMFIISEVMFFFSFFWSYFYISLSPNIAIGCVWPPYGLTVYSYM GLPLLNTVLLLLSGAILTDGYTILTEQKAVHEKNEKVLAVEEAFKNLMNLYKTKNSINTL TFVDERRDKFFGKESRQEDKIAEQKLIAISAGVKELRDLDWDLYFFENPENIEPNYKEPT NLSVIEYALITIYLKKRNKVIKTRLYFTLLCAVVFLACQGYEYFFAPFSMNDGIYGSLFF LLTGFHGFHVLVGSILIGIITIRFIVGNFNLLNVGTNFQIYKNKSTGFACTLFYWHFVDI VWIFLYIVIYWWGSR
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (Cox3) is a crucial component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain. This chain plays a vital role in oxidative phosphorylation, driving cellular energy production. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and the ATP synthase, responsible for ATP synthesis. Cytochrome c oxidase, specifically, catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site located in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC utilizes four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Cytochrome c oxidase subunit 3 (cox3) in Dictyostelium discoideum?

Cytochrome c oxidase subunit 3 (cox3) in D. discoideum functions as an essential component of the mitochondrial respiratory complex IV (cytochrome c oxidase). This complex is crucial for cellular respiration, catalyzing the final step of the electron transport chain where electrons are transferred from cytochrome c to molecular oxygen. Cox3 specifically contributes to the formation of the functional core of the enzyme complex alongside subunits I and II .

The catalytic reaction mediated by this complex can be represented as:
4 ferrocytochrome c + O₂ + 4 H⁺ = 4 ferricytochrome c + 2 H₂O

How does the structure of D. discoideum cox3 compare to homologs in other organisms?

D. discoideum cox3 shows varying degrees of sequence conservation when compared to homologs in other organisms. Phylogenetic analyses place D. discoideum (Amoebozoa) between plants and animals in the evolutionary tree, but closer to animals than plants . This is reflected in the protein structure and function.

Key comparative features:

  • D. discoideum mitochondrial genetics differ from metazoans in several aspects

  • The D. discoideum mitochondrial genome is approximately 56 kb and encodes 38 proteins

  • About 32.1% of D. discoideum mitochondrial proteins have no homologs in humans, S. cerevisiae, or the ancestral alphaproteobacteria

  • Only 504 of the 936 D. discoideum mitochondrial proteins have homologs in the human mitochondrial proteome

This divergence underscores D. discoideum's unique evolutionary position and makes it a valuable comparative model for mitochondrial protein studies.

What expression systems are effective for producing recombinant D. discoideum cox3?

Several expression systems have been successfully employed for producing recombinant D. discoideum proteins, including cox3:

Expression SystemAdvantagesLimitationsReference
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications
D. discoideum itselfNative post-translational modifications, proper foldingLower yield, more complex culturing
BaculovirusGood for complex proteins, proper foldingHigher cost, longer expression time
Mammalian cellsSuperior post-translational modificationsHighest cost, complex maintenance

For recombinant cox3 specifically, E. coli expression systems with N-terminal His-tags have been successfully used to produce functional protein . The methodology typically involves:

  • Gene cloning into an appropriate expression vector

  • Transformation into competent E. coli cells

  • Induction of protein expression (often with IPTG)

  • Cell lysis and protein purification using affinity chromatography

  • Quality control by SDS-PAGE analysis to confirm purity (>90% purity can be achieved)

For more native-like protein, D. discoideum itself can serve as a host, which has gained recognition as a promising eukaryotic expression system for heterologous proteins requiring complex post-translational modifications .

What are the optimal storage conditions for recombinant D. discoideum cox3?

The optimal storage conditions for recombinant D. discoideum cox3 vary depending on the formulation:

FormStorage TemperatureBuffer CompositionShelf LifeNotes
Lyophilized-20°C/-80°CTris/PBS-based buffer, 6% Trehalose, pH 8.012 monthsPreferred for long-term storage
Liquid-20°C/-80°CTris-based buffer with 50% glycerol6 monthsConvenient for immediate use
Working aliquots4°CVarious buffersUp to one weekNot recommended for long-term storage

For reconstitution of lyophilized protein, it is recommended to:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is typical)

  • Aliquot for long-term storage at -20°C/-80°C

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity .

How can recombinant D. discoideum cox3 be used to study mitochondrial function?

Recombinant D. discoideum cox3 serves as a valuable tool for investigating various aspects of mitochondrial function:

  • Respiratory Complex Assembly Studies

    • The protein can be used in reconstitution experiments to study cytochrome c oxidase assembly

    • Tagged versions allow for pull-down assays to identify interaction partners

  • Functional Assays

    • Enzymatic activity can be measured using cytochrome c oxidation assays

    • The catalytic reaction (4 ferrocytochrome c + O₂ + 4 H⁺ = 4 ferricytochrome c + 2 H₂O) can be monitored spectrophotometrically

  • Structural Studies

    • Purified recombinant protein can be used for crystallization attempts and structural determination

    • Structure-function relationships can be investigated through site-directed mutagenesis

  • Mitochondrial Disease Modeling

    • Mutations associated with mitochondrial diseases can be introduced into recombinant cox3

    • The effects on protein function can be characterized in vitro

These applications benefit from D. discoideum's position as an established model organism for studying mitochondrial genetics and bioenergetics .

What methods are available for genetic engineering of cox3 in D. discoideum?

Recent advances have expanded the molecular toolkit for genetic manipulation of cox3 and other genes in D. discoideum:

  • Conventional Transfection Methods

    • These are optimized for axenic cell lines growing in liquid cultures

    • Include different selectable markers and marker recycling

    • Enable homologous recombination and insertional mutagenesis

  • Novel Bacterial Selection Systems

    • Allow genetic manipulation of non-axenic wild-type cells that feed only on bacteria

    • Overcome limitations in traditional methods that were difficult to apply to wild-type D. discoideum

    • Enable the study of uncorrupted signaling and motility processes

  • CRISPR/Cas9 Technology

    • Recently adapted for D. discoideum

    • Used successfully to generate knockout mutants

    • Example methodology includes:

      • Selection of sgRNA sequences using specialized design tools

      • Cloning into appropriate plasmids (e.g., pTM1285)

      • Electroporation into D. discoideum cells

      • Selection with antibiotics (e.g., G418)

      • Clonal isolation and genotype verification

These methods facilitate various genetic manipulations of cox3, including:

  • Gene knockout studies to assess the role of cox3 in mitochondrial function

  • Introduction of reporter tags for localization studies

  • Site-directed mutagenesis to study structure-function relationships

  • Expression of modified cox3 variants in different genetic backgrounds

How does cox3 contribute to mitochondrial genome stability in D. discoideum?

The role of cox3 in maintaining mitochondrial genome stability in D. discoideum is complex and interconnected with various DNA repair pathways:

  • DNA Damage Response

    • D. discoideum has a unique set of DNA repair mechanisms that impact genome stability

    • The Fanconi Anemia (FA) pathway components are partially conserved in D. discoideum

    • While majority of FA proteins are not conserved in yeast, D. discoideum has an expanded repertoire similar to humans

  • Interstrand Crosslink (ICL) Repair

    • In S. cerevisiae, ICL repair is mainly due to Nucleotide Excision Repair (NER)

    • D. discoideum has orthologs of genes encoding FANCI/D2 and related ubiquitin ligases

    • The enzyme Xpf plays a crucial role in tolerance to DNA-damaging agents like cisplatin

  • Mitochondrial Gene Expression

    • Cox3 is one of the 38 proteins encoded by the D. discoideum mitochondrial genome

    • Proper expression of cox3 and other mitochondrially-encoded proteins is essential for respiratory function

    • Many unique mitochondrial proteins in D. discoideum are involved in mtDNA gene expression

Disruptions in cox3 function can potentially impact these pathways, affecting mitochondrial genome stability and cellular energy metabolism.

What role does cox3 play during D. discoideum development and differentiation?

Cox3 and mitochondrial function are intricately linked to D. discoideum's unique developmental cycle:

  • Developmental Transitions

    • Mitochondrial activity appears to increase at the beginning of starvation-induced development

    • Impairment of mtDNA genes can affect aggregation and slug phototaxis

    • Pharmacological inhibition of respiratory complexes can induce aggregation

  • Metabolic Reprogramming

    • Mitochondrial proteins are dynamically expressed during development

    • The mitochondrial proteome undergoes significant remodeling during the transition from vegetative growth to multicellular development

  • Differentiation Processes

    • D. discoideum can differentiate into two major cell types: spore cells and stalk cells

    • Energy metabolism shifts are associated with these differentiation processes

    • Mitochondrial function, including cox3 activity, likely influences cell fate decisions

  • Social Behavior

    • D. discoideum is used to study social evolution and multicellularity

    • Mitochondrial genes may influence cooperative behaviors

    • Cox3 function could potentially affect fitness in social contexts

The exact mechanisms linking cox3 function to these developmental processes remain an active area of research, offering opportunities for further investigation.

How can mutations in cox3 be studied using D. discoideum as a model system?

D. discoideum offers several advantages for studying the effects of cox3 mutations:

  • Genetic Manipulation Approaches

    • Site-directed mutagenesis to introduce specific mutations

    • CRISPR/Cas9 technology for precise genome editing

    • Homologous recombination for gene replacement

  • Phenotypic Assays

    • Growth rate measurements in different media compositions

    • Phagocytosis assays using fluorescently labeled particles

    • Mitochondrial membrane potential assessment using dyes like JC-1

    • Oxygen consumption measurements to assess respiratory function

  • Comparative Studies

    • Interactions with bacterial species can reveal phenotypic effects

    • D. discoideum with cox3 mutations can be tested for ability to prey on different bacteria

    • Bacteriolytic activity of cell extracts can be measured against various bacterial species

  • Development and Differentiation Analysis

    • Time-lapse imaging to monitor developmental progression

    • Quantification of timing and efficiency of aggregation

    • Assessment of spore versus stalk cell ratios

    • Evaluation of fruiting body morphology

These approaches can reveal how cox3 mutations impact not only basic mitochondrial function but also complex cellular processes and multicellular development.

What are the technical challenges in using recombinant D. discoideum cox3 in structural studies?

Several technical challenges must be addressed when using recombinant D. discoideum cox3 for structural studies:

Research suggests that using D. discoideum itself as an expression host may help overcome some of these challenges, as it provides the necessary machinery for proper folding and post-translational modifications of complex proteins .

How does D. discoideum cox3 compare to homologs in human mitochondrial disease models?

D. discoideum cox3 shares important similarities and differences with human homologs relevant to mitochondrial disease research:

  • Sequence Conservation

    • About 54% (504 of 936) of D. discoideum mitochondrial proteins have homologs in humans

    • This partial conservation allows for modeling of some human mitochondrial diseases

    • Key functional domains of cox3 show higher conservation than peripheral regions

  • Disease-Relevant Mutations

    • Several human mitochondrial diseases involve cox3 mutations

    • Analogous mutations can be introduced into D. discoideum cox3

    • Effects on cytochrome c oxidase assembly and function can be studied

  • Phenotypic Manifestations

    • COX deficiency in humans typically affects high-energy demanding tissues

    • In D. discoideum, cox3 mutations may manifest as growth defects, developmental abnormalities, or phagocytosis deficiencies

    • The single-celled to multicellular transition of D. discoideum offers unique insights into tissue-specific effects

  • Compensatory Mechanisms

    • D. discoideum has unique mitochondrial proteins not found in humans

    • These may provide alternative or compensatory pathways

    • Understanding these differences can reveal novel therapeutic approaches

This comparative approach contributes to our understanding of fundamental mitochondrial biology and potential therapeutic strategies for mitochondrial diseases.

What insights does D. discoideum cox3 provide about mitochondrial evolution?

D. discoideum cox3 offers valuable evolutionary insights due to the organism's position in the eukaryotic tree of life:

  • Phylogenetic Position

    • Amoebozoa diverged before Opisthokonta (animals and fungi), but after Plantae

    • D. discoideum is more closely related to animals than plants

    • This makes it an informative comparative model for mitochondrial evolution

  • Mitochondrial Genome Features

    • D. discoideum mitochondrial genome is ~56 kb, circular, double-stranded DNA

    • It encodes 38 proteins, 2 rRNAs, and 18 tRNAs

    • The genome includes several genes with unknown functions

  • Protein Conservation Analysis

    • Only 286 D. discoideum mitochondrial proteins have homologs in Rickettsia prowazekii (an α-proteobacterium related to the mitochondrial ancestor)

    • 32.1% of D. discoideum mitochondrial proteins have no homologs in humans, yeast, or ancestral bacteria

    • This suggests significant de novo evolution of mitochondrial proteins after the divergence of Amoebozoa

Organism ComparisonNumber of Homologous ProteinsPercentage of D. discoideum Mitochondrial Proteome
Homo sapiens50453.8%
Saccharomyces cerevisiae40443.2%
Rickettsia prowazekii28630.6%
No homologs in any30032.1%

These findings highlight the dynamic nature of mitochondrial evolution and the value of D. discoideum as a model for understanding the diversification of mitochondrial functions across eukaryotes.

What new genetic engineering methods are advancing cox3 research in D. discoideum?

Recent methodological breakthroughs have significantly enhanced the genetic manipulation capabilities for cox3 and other genes in D. discoideum:

  • Bacterial Selection Systems

    • Traditional methods were optimized for axenic cell lines growing in liquid media

    • New approaches allow selection of D. discoideum transfectants by growth on bacteria

    • This enables manipulation of wild-type cells and strains with defects in macropinocytosis

    • These methods are faster, often yielding transfected cells within days

  • CRISPR/Cas9 Genome Editing

    • Successfully adapted for D. discoideum with high efficiency

    • Methodology includes:

      • sgRNA design using specialized tools (e.g., http://www.rgenome.net/cas-designer/)

      • Golden-gate assembly cloning into vectors like pTM1285

      • Electroporation using optimized conditions

      • Selection with antibiotics followed by limiting dilution cloning

  • Expression System Optimization

    • Use of homologous promoters (e.g., discoidin I γ promoter) for controlled expression

    • Leader peptide sequences (e.g., contact site A leader) to ensure proper protein localization

    • Expression timing control based on promoter characteristics (e.g., late growth and early development)

  • Complete Genetic Manipulation Toolkit

    • Extrachromosomal vectors for transient expression

    • "Safe haven" integration sites for uniform cell-to-cell expression

    • Efficient gene knock-in and knock-out protocols

    • Inducible expression systems for temporal control

These advances have removed previous limitations, allowing researchers to manipulate cox3 in a wider range of genetic backgrounds and experimental conditions.

How can high-throughput proteomics approaches enhance our understanding of cox3 function?

High-throughput proteomics offers powerful methods to investigate cox3 function within the broader mitochondrial context:

  • Mitochondrial Protein Compendium Development

    • Recent efforts have generated a high-confidence mitochondrial protein compendium in D. discoideum

    • This involved multiplexed protein quantitation and homology analyses

    • The methodology combined mass spectrometry with mathematical modeling

    • Validation included mitochondrial targeting sequence prediction and live-cell imaging

    • The final compendium consists of 936 high-confidence mitochondrial proteins

  • Quantitative Interaction Proteomics

    • Techniques to identify cox3 interaction partners:

      • Affinity purification coupled with mass spectrometry (AP-MS)

      • Proximity labeling approaches like BioID or APEX

      • These methods can reveal the protein interaction network of cox3

  • Dynamic Analysis During Development

    • Proteomics can track changes in cox3 expression and interactions during:

      • Vegetative growth

      • Starvation-induced aggregation

      • Multicellular development stages

      • These analyses reveal metabolic reprogramming during development

  • Fractionation and Activity Correlation

    • Biochemical fractionation coupled with activity assays

    • Example methodology:

      • Anion exchange chromatography at controlled pH

      • Size-exclusion chromatography for further purification

      • Correlation of protein presence with enzymatic activity

      • This approach has been successful for identifying functional protein complexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.