Recombinant Dictyostelium discoideum Cytochrome c1, heme protein, mitochondrial (cyc1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cyc1; DDB_G0292594; Cytochrome c1, heme protein, mitochondrial; Cytochrome c-1; Complex III subunit 4; Complex III subunit IV; Cytochrome b-c1 complex subunit 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-275
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
Target Protein Sequence
ITTSTTLLSDDFVQPTSYPWEHRFPWQSYDHAAIRRGHQVYTQVCSTCHSLNLISYRHLA NVAYTPEELKAMAADTTVMDGPDSEGDMFERKGQVTDFHPKPYPNSNAARFANNGALPPD LSLVIKARGAHEDYVFSLLTGYCEPPAGVRVVGGQYFNPYFPGTKIAMAPPLADGMVEYD DGTDNSMSQMAKDVSTFLCWASEPEHDDRKKLGMKVLLGVSIIALPLFYWKRLKWSVIKT RKISFKD
Uniprot No.

Target Background

Function

Cytochrome c1 is a component of ubiquinol-cytochrome c oxidoreductase (complex III, CIII), a multi-subunit transmembrane complex within the mitochondrial electron transport chain. This complex plays a crucial role in oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that powers transmembrane transport and ATP synthase. The cytochrome b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c, coupling this redox reaction with proton translocation across the inner mitochondrial membrane via the Q cycle. This process consumes two protons from the matrix, releases four protons into the intermembrane space, and transfers two electrons to cytochrome c. Cytochrome c1, a catalytic core subunit containing a c-type heme, transfers electrons from the Rieske [2Fe-2S] iron-sulfur cluster to cytochrome c.

Database Links
Protein Families
Cytochrome c family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

Basic Structure and Function

Q: What are the optimal methods for expressing and purifying functional recombinant D. discoideum Cytochrome c1?

A: Based on documented approaches, the most effective method for producing recombinant D. discoideum Cytochrome c1 involves:

  • Expression System: E. coli has been successfully used as an expression host for D. discoideum Cytochrome c1 .

  • Construct Design: The construct should contain:

    • The mature protein sequence (amino acids 29-275)

    • An N-terminal His-tag for purification

    • Appropriate bacterial promoter and terminator sequences

  • Purification Protocol:

    • Affinity chromatography using nickel or cobalt columns

    • Verification of purity (>90%) by SDS-PAGE

    • Lyophilization for long-term storage

  • Storage Conditions:

    • Store as lyophilized powder

    • For working solutions, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for aliquots stored at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

This approach yields a recombinant protein suitable for structural studies, enzymatic assays, and antibody production.

Functional Validation Techniques

Q: How can researchers validate the functionality of recombinant D. discoideum Cytochrome c1?

A: Several complementary approaches can validate the functional integrity of recombinant Cytochrome c1:

  • Spectroscopic Analysis: Properly folded cytochrome c1 with incorporated heme exhibits characteristic UV-visible absorption spectra. By analogy with other D. discoideum heme proteins, such as the NrdB protein described in search result , you should expect to observe:

    • Specific absorption bands at wavelengths corresponding to the heme group (typically around 330-370 nm for diiron-oxo absorption and 390-420 nm for tyrosyl radical absorption)

    • Changes in these spectra upon reduction/oxidation

  • EPR Spectroscopy: This technique can characterize the electronic structure of the heme group and confirm proper incorporation. The EPR spectrum should show:

    • Well-resolved hyperfine couplings

    • Temperature-dependent behavior similar to that observed for other heme proteins

  • Electron Transfer Assays: Functional cytochrome c1 should demonstrate the ability to:

    • Accept electrons from an appropriate donor

    • Transfer electrons to cytochrome c

    • These activities can be monitored using artificial electron donors/acceptors and spectroscopic methods

  • Reconstitution Studies: Incorporation of the recombinant protein into isolated mitochondrial membranes or depleted Complex III preparations should restore electron transport activity.

  • Complementation Assays: Introduction of the recombinant protein into D. discoideum cells with dysfunctional or deleted native cyc1 should rescue the associated phenotypic defects.

Comparative Analysis with Other Organisms

Q: How does D. discoideum Cytochrome c1 compare structurally and functionally to its homologs in other organisms?

A: D. discoideum Cytochrome c1 shares fundamental functional similarities with homologs in other organisms but exhibits distinct characteristics:

These differences highlight the value of studying D. discoideum cytochrome c1 as a model that may reveal alternative mechanisms of electron transport chain function and assembly.

Role in Development and Differentiation

Q: What phenotypic effects would result from genetic manipulation of cyc1 in D. discoideum?

A: Based on studies of other mitochondrial proteins in D. discoideum, genetic manipulation of cyc1 would likely produce several observable phenotypes:

  • Growth Defects: Disruption of respiratory chain components typically results in growth impairments. For example, knockout of DJ-1, a protein involved in mitochondrial function, leads to growth defects in D. discoideum .

  • Altered Mitochondrial Function:

    • Reduced electron transport chain activity

    • Decreased ATP production

    • Potential compensatory upregulation of alternate energy pathways

    • Changes in mitochondrial morphology or quantity

  • Developmental Abnormalities: Mitochondrial dysfunction often affects D. discoideum's developmental cycle:

    • The DdTPS8 knockout mutant (a different gene) exhibited slow progression in development

    • Depletion of class I RNR drastically reduced spore formation and viability

    • Genetic manipulation of the Skp1 Prolyl 4-Hydroxylase affected glycosylation and development

  • Cellular Processes Impacted: Based on the role of mitochondria in D. discoideum:

    • Chemotaxis may be impaired due to energy deficiencies

    • Phagocytosis could be affected, as seen with DJ-1 knockdown under oxidative stress

    • Cell differentiation patterns might be altered

  • Experimental Approaches for Assessment:

    • Growth rate measurements in axenic culture

    • Development on bacterial lawns or filters

    • Analysis of spore formation and viability

    • Examination of mitochondrial morphology and function

    • Assessment of cellular processes like phagocytosis and chemotaxis

Protein-Protein Interactions in the Electron Transport Chain

Q: What techniques are most effective for studying Cytochrome c1 interactions with other components of the electron transport chain in D. discoideum?

A: Several complementary techniques are particularly valuable for studying cytochrome c1 interactions in D. discoideum:

  • Co-Immunoprecipitation with Recombinant Antibodies:

    • Recent development of recombinant antibodies against D. discoideum proteins provides valuable tools

    • These antibodies can be used to pull down cytochrome c1 along with its interacting partners

    • Recovered proteins can be identified by mass spectrometry

  • Mass Spectrometry-Based Proteomics:

    • As demonstrated in the study of AMPK effects on mitochondrial proteins

    • Can identify both interacting proteins and their phosphorylation states

    • Example data table format from such studies:

    ProteinAccessionPhosphositesControlTreatmentFold Change
    Cyc1Q54D07S/T/Y positionsIntensityIntensityRatio
  • Blue Native PAGE:

    • Allows analysis of intact respiratory chain complexes

    • Can reveal supercomplexes containing cytochrome c1

    • Useful for comparing complex assembly between wild-type and mutant strains

  • Crosslinking Mass Spectrometry:

    • Chemical crosslinking of proteins in close proximity

    • Digestion and identification of crosslinked peptides

    • Maps interaction surfaces between cytochrome c1 and its partners

  • Fluorescence-Based Approaches:

    • D. discoideum researchers have developed fluorescent probes for live cell imaging

    • Similar approaches could be adapted for monitoring cytochrome c1 interactions

    • FRET (Fluorescence Resonance Energy Transfer) can detect dynamic protein interactions

These techniques can be combined to build a comprehensive map of cytochrome c1 interactions within the D. discoideum mitochondrial respiratory chain.

Analyzing Redox Properties

Q: What methods should be used to analyze the redox properties of D. discoideum Cytochrome c1?

A: The redox properties of D. discoideum cytochrome c1 can be analyzed using several complementary approaches:

Protein Modifications and Regulation

Q: How do post-translational modifications affect D. discoideum Cytochrome c1 function, and how can these be studied?

A: Based on studies of D. discoideum mitochondrial proteins, several approaches can be used to study post-translational modifications of cytochrome c1:

  • Phosphorylation Analysis:

    • Mass spectrometry-based phosphoproteomics has been successfully applied to D. discoideum mitochondria

    • This technique identified 103 phosphoproteins in D. discoideum mitochondria

    • Several components of the electron transport chain were found to be phosphorylated, including multiple subunits of ATP synthase

    • Similar approaches could identify phosphorylation sites on cytochrome c1

  • Functional Impact Assessment:

    • The study of AMPK overexpression demonstrated that changes in phosphorylation state of mitochondrial proteins correlate with elevated mitochondrial respiratory activity

    • Site-directed mutagenesis of identified modification sites (changing phosphorylated residues to alanine or phosphomimetic residues) can determine their functional significance

  • Regulation During Development:

    • D. discoideum undergoes complex development, during which protein modification patterns may change

    • Samples from different developmental stages can be compared to identify stage-specific modifications

  • Redox Modifications:

    • Cytochrome c1 may undergo redox-dependent modifications

    • Studies of DJ-1 in D. discoideum showed that oxidative stress affects mitochondrial function

    • Similar approaches could be used to study how oxidative stress affects cytochrome c1 modifications

  • Proteomic Data Analysis Approach:

    • Using techniques similar to those described in search result , researchers can generate comprehensive modification data

    • A typical data presentation format would be:

    ProteinSiteModificationControlTreatmentFold ChangePredicted Effect
    Cyc1S/T/YPhosphorylationIntensityIntensityRatioFunction

Biogenesis and Assembly Mechanisms

Q: What is known about the biogenesis and assembly of Cytochrome c1 into Complex III in D. discoideum, and how can this be further investigated?

A: The biogenesis of cytochrome c1 in D. discoideum involves several steps that can be investigated using specific approaches:

  • Heme Attachment Mechanism:

    • Cytochrome c1 requires covalent attachment of heme via conserved CXXCH motifs

    • Most eukaryotes use holocytochrome c synthase (HCCS) for heme attachment

    • While humans encode a single bifunctional HCCS for both cytochrome c and c1, other organisms like yeast and Plasmodium encode separate enzymes for each cytochrome

    • The specific mechanism in D. discoideum could be investigated by:

      • Identifying HCCS homologs in the D. discoideum genome

      • Gene knockout or conditional knockdown studies

      • In vitro reconstitution of heme attachment

  • Import and Processing:

    • The recombinant protein data indicates that mature cytochrome c1 begins at amino acid 29 , suggesting processing of a mitochondrial targeting sequence

    • The mechanism can be studied using:

      • In vitro import assays with isolated mitochondria

      • Identification of processing proteases

      • Mutagenesis of the targeting sequence

  • Complex III Assembly:

    • The integration of cytochrome c1 into Complex III requires coordination with other subunits

    • This can be investigated using:

      • Blue Native PAGE to analyze complex assembly intermediates

      • Pulse-chase experiments to track newly synthesized cytochrome c1

      • Analysis of assembly factors through genetic screens

  • Regulation of Expression:

    • The expression of cytochrome c1 likely changes during development and in response to metabolic conditions

    • This can be studied using:

      • RT-PCR or RNA-Seq to measure transcript levels

      • Western blotting with recombinant antibodies to measure protein levels

      • Reporter gene constructs to monitor promoter activity

  • Experimental Approaches from Related Studies:

    • Methods used to study gene clusters in D. discoideum can be adapted

    • Techniques for analyzing developmental regulation of genes provide useful templates

    • The proteomic approaches used to study mitochondrial biogenesis would be directly applicable

Understanding cytochrome c1 biogenesis in D. discoideum may reveal unique aspects of mitochondrial assembly in this organism and provide insights into the evolution of these essential processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.