Recombinant Dictyostelium discoideum Delta (14)-sterol reductase (erg24)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant D. discoideum Delta (14)-Sterol Reductase (erg24)

erg24 is a transmembrane protein encoded by the erg24 gene in D. discoideum. The recombinant form is expressed in E. coli with an N-terminal His-tag for purification . It catalyzes the reduction of the C14=C15 double bond in 4,4-dimethyl-cholesta-8,14,24-trienol to produce 4,4-dimethyl-cholesta-8,24-dienol, a critical step in ergosterol biosynthesis .

Key Properties of Recombinant erg24

PropertyDetails
Source OrganismDictyostelium discoideum (Slime mold)
Expression HostE. coli
Protein LengthFull-length (1-462 amino acids)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -20°C/-80°C

Enzymatic Function and Biological Role

erg24 operates in the peroxisomal membrane of D. discoideum, distinguishing it from orthologs in other eukaryotes (e.g., yeast ERG24 localizes to the endoplasmic reticulum) . Key functional insights include:

  • Catalytic Activity: Reduces sterol intermediates during ergosterol synthesis, essential for membrane integrity .

  • Pathway Context: Part of a peroxisomal enzyme cluster in D. discoideum that includes squalene synthase, squalene epoxidase, and oxidosqualene cyclase .

Sterol Biosynthesis Pathway in D. discoideum

EnzymeLocalizationRole
Squalene SynthasePeroxisomal membraneConverts farnesyl diphosphate to squalene
Squalene EpoxidasePeroxisomal membraneEpoxidizes squalene to 2,3-oxidosqualene
Oxidosqualene CyclasePeroxisomal membraneCyclizes 2,3-oxidosqualene to lanosterol/cycloartenol
erg24Peroxisomal membraneReduces Δ14 double bond in sterol intermediates

Expression and Purification Workflow

  1. Cloning: Full-length erg24 gene (XM_633521.1) cloned into an E. coli vector with a His-tag .

  2. Expression: Induced under optimized conditions for soluble protein yield.

  3. Purification: Immobilized metal affinity chromatography (IMAC) using the His-tag .

Research Findings and Applications

  • Peroxisomal Sterol Biosynthesis: D. discoideum erg24’s peroxisomal localization challenges the traditional view of sterol synthesis occurring solely in the endoplasmic reticulum .

  • Functional Complementation: D. discoideum cycloartenol-C-24-methyltransferase (another peroxisomal enzyme) can complement yeast erg6 mutants, highlighting evolutionary conservation .

  • Biotechnological Use: D. discoideum’s eukaryotic post-translational modification machinery makes it a promising host for producing complex recombinant proteins like erg24 .

Comparative Analysis with Yeast ERG24

FeatureD. discoideum erg24S. cerevisiae ERG24
LocalizationPeroxisomal membrane Endoplasmic reticulum
Aerobic ViabilityEssential under aerobic conditionsViable only under anaerobic conditions
Sterol ProductErgosterol precursorsErgosta-8,14-dienol (ignosterol)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
erg24; DDB_G0284407; Delta(14-sterol reductase; C-14 sterol reductase; Sterol C14-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-462
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
erg24
Target Protein Sequence
MSAVRNRNNVEKQSNNGAQLTEVQKKELADLQKVHPANEFGGIIGTFLLTFILPVVVYWI WASIEFNNGYLLRPETLSVEGVKAFLAQLYHYVITYAYPTKEAAIIYFSWFGFQAFLQHV VPGRKVLGSPLPGGARLEYTLNGWASWWITLIVIPIAIYFGLFKATILIDNYAPMMTVVN IWSFVFTFLLKIHAKLKGEEERMSGHFFYDFWMGFARNPRIGSFDLKLFCEARPGLILWV LMNFSIAAKQLEVYGEISLSVILVCCFHFWYIADYYYHEEAILTTMDIITEKFGYMLVYG DLSWVPFTYCFQCYYLYKHLVNGAPLHISIGYAIFVVSLKCFGFYLFRWVNSQKHDFRRN PEAPVWGKPAEFILTKRGTKLLCSGFWGICRHLNYTGDIILSWAWCLPCQFDSLAPYFYG IYFTSLDLHRCWRDHNACLVKYGDDWRAYCKRVPYNFIPGLI
Uniprot No.

Target Background

Function
This enzyme reduces the C14=C15 double bond of 4,4-dimethyl-cholesta-8,14,24-trienol to produce 4,4-dimethyl-cholesta-8,24-dienol.
Database Links
Protein Families
ERG4/ERG24 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Delta (14)-sterol reductase (erg24) in Dictyostelium discoideum?

Delta (14)-sterol reductase (erg24) plays a crucial role in sterol biosynthesis in eukaryotic organisms. While specific characterization in Dictyostelium discoideum is still emerging, studies in other organisms have demonstrated that erg24 catalyzes the reduction of the C-14 double bond in sterol intermediates during ergosterol biosynthesis . In fungal species like Aspergillus fumigatus, erg24 is essential for viability and proper cellular function . Dictyostelium discoideum has been established as a valuable model organism for studying numerous aspects of eukaryotic cell biology, including cell motility, cell adhesion, macropinocytosis, phagocytosis, host-pathogen interactions, and multicellular development . Understanding the function of erg24 in this organism would provide insights into the conservation of sterol biosynthesis pathways across eukaryotes.

How does the structure of Dictyostelium discoideum erg24 compare to homologous proteins in other organisms?

While the search results don't provide specific structural information for Dictyostelium discoideum erg24, comparative analyses can be inferred from studies of homologous proteins. In Aspergillus fumigatus, two endoplasmic reticulum-localized sterol C-14 reductases (Erg24A and Erg24B) have been characterized . Similarly, Candida albicans possesses an ERG24 gene encoding sterol C-14 reductase . Based on studies in these organisms, we can anticipate that Dictyostelium discoideum erg24 likely contains conserved domains necessary for sterol C-14 reductase activity and is probably localized to the endoplasmic reticulum. Researchers should perform sequence alignment analyses with known erg24 proteins from other species to identify conserved functional domains when working with the Dictyostelium enzyme.

What recombinant antibody techniques are available for studying proteins in Dictyostelium discoideum?

The Dictyostelium research community has developed several approaches for generating recombinant antibodies (rAbs) against Dictyostelium antigens. These techniques include:

  • Hybridoma sequencing: This approach involves sequencing existing hybridoma cell lines that produce monoclonal antibodies against Dictyostelium antigens .

  • Phage display technology: This technique allows for the discovery and characterization of new recombinant antibodies against Dictyostelium targets .

These methods have been successfully employed to generate panels of recombinant antibodies for labeling and characterizing proteins and subcellular compartments in Dictyostelium discoideum . Such recombinant antibodies provide reliable and renewable reagents that can be shared throughout the research community, addressing the challenge of limited commercial availability of research tools for this model organism.

What are the optimal expression systems for producing recombinant Dictyostelium discoideum erg24?

When expressing recombinant Dictyostelium discoideum erg24, researchers should consider several expression systems based on the specific research objectives:

  • Yeast expression systems: Based on complementation studies with other sterol biosynthesis enzymes, Saccharomyces cerevisiae has proven to be an effective heterologous expression system. For example, Chlamydomonas reinhardtii ERG3 was successfully expressed in S. cerevisiae erg3Δ strains to confirm its function as a sterol C-5 desaturase . A similar approach could be employed for Dictyostelium discoideum erg24, using S. cerevisiae erg24Δ knockout strains.

  • E. coli expression systems: While prokaryotic systems may lack post-translational modifications present in eukaryotes, they can be useful for producing protein for structural studies or antibody production.

  • Dictyostelium expression systems: Homologous expression in Dictyostelium itself may provide the most physiologically relevant conditions for studying the protein's function and interactions.

The choice of expression system should be guided by the specific experimental objectives, considering factors such as protein folding requirements, post-translational modifications, and functional assay compatibility.

How can complementation assays in yeast be designed to confirm erg24 function in Dictyostelium discoideum?

To design effective complementation assays for confirming erg24 function in Dictyostelium discoideum, researchers can follow this methodological approach:

  • Generate yeast erg24 knockout strains: Create S. cerevisiae strains with the endogenous ERG24 gene disrupted by homologous recombination, replacing it with a selectable marker such as URA3 .

  • Confirm phenotypes of knockout strains: Verify that the erg24Δ strains display characteristic phenotypes, which based on studies with other sterol biosynthesis enzymes may include:

    • Inability to grow on non-fermentable carbon sources

    • Hypersensitivity to cycloheximide or other cellular inhibitors

    • Alterations in sterol profiles

  • Construct expression vectors: Clone the Dictyostelium discoideum erg24 ORF into appropriate yeast expression vectors containing selectable markers such as LEU2 .

  • Transform knockout strains: Transform the erg24Δ strains with:

    • Empty vector (negative control)

    • Vector expressing yeast ERG24 (positive control)

    • Vector expressing Dictyostelium discoideum erg24

  • Assess functional complementation: Test whether expression of Dictyostelium erg24 rescues the mutant phenotypes by:

    • Growth assays on non-fermentable carbon sources like acetate

    • Sensitivity tests with cycloheximide

    • Sterol profile analysis using gas chromatography-mass spectrometry

Successful complementation of yeast erg24Δ mutant phenotypes would provide strong evidence that the Dictyostelium gene functions as a sterol C-14 reductase.

What phenotypic analyses can be performed to characterize erg24 mutants in Dictyostelium discoideum?

Based on studies of erg24 mutants in other organisms, several phenotypic analyses can be employed to characterize erg24 mutants in Dictyostelium discoideum:

  • Growth rate assessment: Measure growth rates in liquid culture and on solid media. In Candida albicans, erg24 mutants exhibited doubling times at least twice that of wild-type strains .

  • Drug sensitivity profiling: Test sensitivity to various compounds including:

    • Antifungal agents (azoles, allylamines)

    • Cellular inhibitors (cycloheximide, cerulenin, fluphenazine, brefeldin A)

    • Polyene antibiotics like nystatin, which has been used to identify ergosterol mutants in Chlamydomonas reinhardtii

  • Developmental studies: Assess the ability of mutants to undergo the characteristic multicellular development of Dictyostelium.

  • Cell motility and chemotaxis assays: Evaluate whether sterol composition changes affect cell movement and chemotactic responses.

  • Sterol profile analysis: Determine changes in sterol composition using techniques such as gas chromatography-mass spectrometry.

  • Ion homeostasis assessment: Based on findings in Aspergillus fumigatus, investigate whether erg24 mutants exhibit disrupted ion homeostasis by testing growth in the presence of various metal ions .

What are the major challenges in expressing and purifying recombinant Dictyostelium discoideum erg24?

Expression and purification of recombinant Dictyostelium discoideum erg24 presents several technical challenges:

  • Membrane protein solubility: As a sterol biosynthesis enzyme, erg24 is likely membrane-associated, making it difficult to express in soluble form.

  • Maintaining enzymatic activity: Preserving the native structure and activity of the enzyme during purification is essential for functional studies.

  • Expression system compatibility: The choice of expression system can significantly impact protein yield and activity.

Potential solutions include:

  • Use of detergents: Employ mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin for extraction and purification.

  • Fusion tags: Incorporate solubility-enhancing tags like maltose-binding protein (MBP) or SUMO.

  • Nanodiscs or liposomes: Reconstitute purified protein into lipid environments that mimic native membranes.

  • Co-expression with chaperones: Consider co-expressing molecular chaperones to assist proper folding.

How can the enzymatic activity of recombinant Dictyostelium discoideum erg24 be assayed in vitro?

To assay the enzymatic activity of recombinant Dictyostelium discoideum erg24 in vitro, researchers can implement the following methodology:

  • Substrate preparation: Obtain or synthesize the appropriate sterol substrate (typically containing a C-14 double bond).

  • Reaction conditions: Set up enzymatic reactions containing:

    • Purified recombinant erg24 (or membrane fractions containing the expressed protein)

    • Sterol substrate

    • NADPH as a cofactor (sterol reductases typically use NADPH as an electron donor)

    • Appropriate buffer system (pH ~7.0-7.5)

  • Activity measurement: Monitor reaction progress through:

    • HPLC analysis of substrate disappearance and product formation

    • Mass spectrometry to confirm product identity

    • Spectrophotometric measurement of NADPH consumption at 340 nm

  • Control reactions: Include negative controls (heat-inactivated enzyme) and positive controls (known sterol C-14 reductase from another organism if available).

  • Kinetic analysis: Determine enzyme kinetic parameters (Km, Vmax) by varying substrate concentrations.

What strategies can be employed to generate erg24 knockout or knockdown strains in Dictyostelium discoideum?

Several genetic manipulation strategies can be employed to generate erg24 knockout or knockdown strains in Dictyostelium discoideum:

  • Homologous recombination: Design constructs with selectable markers flanked by homologous regions of the erg24 gene. This approach has been successfully used to disrupt both copies of the ERG24 gene in Candida albicans .

  • CRISPR-Cas9 genome editing: Design guide RNAs targeting erg24 and utilize CRISPR-Cas9 to introduce frameshift mutations or specific deletions.

  • RNA interference (RNAi): For knockdown rather than knockout, develop RNAi constructs targeting erg24 mRNA.

  • Conditional expression systems: If erg24 proves essential, generate conditional mutants using:

    • Tetracycline-regulatable promoters

    • Temperature-sensitive alleles

    • Nitrogen-regulatable promoters (similar to the niiA promoter used to create conditional erg24 mutants in Aspergillus fumigatus)

  • Double mutant approach: If Dictyostelium possesses multiple erg24 homologs (like Aspergillus fumigatus with erg24A and erg24B), consider creating single mutants first to assess redundancy, followed by conditional double mutants .

How does the function of erg24 differ between Dictyostelium discoideum and fungal species?

While specific functional comparison data for Dictyostelium discoideum erg24 is not directly available in the search results, we can infer potential differences based on studies in other organisms:

OrganismEssentialityPhenotypic Effects of MutationBiochemical Function
Aspergillus fumigatusEssential (double mutant)Severe growth defects, disrupted ion homeostasis, accumulation of sterol intermediatesSterol C-14 reduction, ion homeostasis maintenance
Candida albicansNon-essentialSlow growth, increased drug sensitivity, decreased pathogenicity, inability to form germ tubesSterol C-14 reduction
Saccharomyces cerevisiaeNon-essential under aerobic conditionsInability to grow on non-fermentable carbon sources, hypersensitivity to cycloheximideSterol C-14 reduction
Dictyostelium discoideumUnknownUnknownPresumed sterol C-14 reduction

As a soil-dwelling amoeba with both unicellular and multicellular stages, Dictyostelium discoideum likely has unique adaptations in its sterol biosynthesis pathway compared to fungal species. Research should focus on determining whether erg24 is essential in Dictyostelium and characterizing its specific role in this organism's development and physiology.

What insights can comparative genomics provide about the evolution of erg24 in Dictyostelium and related species?

Comparative genomics approaches can provide valuable insights into the evolution of erg24 in Dictyostelium and related species:

  • Phylogenetic analysis: Constructing phylogenetic trees based on erg24 sequences from diverse organisms can reveal evolutionary relationships and potential functional divergence. This approach has been used successfully to study other sterol biosynthesis enzymes like ERG3 .

  • Domain conservation: Analyzing the conservation of functional domains across species can identify critical regions for enzymatic activity and specificity.

  • Gene duplication events: Investigating whether Dictyostelium possesses multiple erg24 paralogs, similar to the two endoplasmic reticulum-localized sterol C-14 reductases (Erg24A and Erg24B) found in Aspergillus fumigatus .

  • Regulatory elements: Comparing promoter regions and regulatory elements can provide insights into the differential expression and regulation of erg24 across species.

  • Lateral gene transfer: Exploring the possibility of horizontal gene transfer events in the evolution of sterol biosynthesis pathways between different eukaryotic lineages.

Such comparative analyses could help determine whether the Dictyostelium erg24 has evolved unique properties related to the organism's lifecycle and ecological niche.

How can recombinant Dictyostelium discoideum erg24 be utilized for drug discovery and development?

Recombinant Dictyostelium discoideum erg24 holds significant potential for drug discovery and development, particularly for antifungal compounds:

  • Target-based screening: Purified recombinant erg24 can be used to screen chemical libraries for potential inhibitors through:

    • In vitro enzymatic assays

    • Thermal shift assays to identify compounds that bind and stabilize the protein

    • Structure-based virtual screening if protein structure is determined

  • Cell-based assays: Compare growth inhibition profiles between wild-type and erg24-modified Dictyostelium strains to identify compounds that specifically target this enzyme.

  • Comparative studies: Test known inhibitors of fungal erg24, such as morpholine antifungals, which have been successful in agricultural applications . The effectiveness of these compounds against Dictyostelium erg24 could provide insights into structural and functional conservation.

  • Resistance development: Study mechanisms of resistance to erg24 inhibitors, which could inform strategies to prevent resistance in clinical antifungal applications.

  • Structure-activity relationship studies: If inhibitors are identified, systematic modification of their chemical structures can optimize potency, selectivity, and pharmacological properties.

The sterol biosynthetic pathway has proven to be a fertile area for antifungal development, and steps like sterol C-14 reduction remain promising targets for novel antifungal development .

What role might erg24 play in Dictyostelium discoideum developmental transitions and multicellularity?

The potential role of erg24 in Dictyostelium discoideum developmental transitions and multicellularity represents an intriguing research question:

  • Sterol composition during development: Investigation of whether sterol composition changes during the transition from unicellular growth to multicellular development could reveal regulatory roles for erg24.

  • Cell signaling impact: Sterols are important components of membrane microdomains (lipid rafts) that serve as platforms for signal transduction. Alterations in erg24 activity could affect signaling pathways critical for development.

  • Cell-cell adhesion: Changes in membrane sterol composition might influence cell-cell adhesion properties necessary for multicellular aggregate formation.

  • Differentiation markers: Based on observations in Candida albicans, where erg24 mutants failed to produce germ tubes , analysis of whether erg24 activity correlates with specific cell differentiation events in Dictyostelium development would be valuable.

  • Developmental timing: Assessment of whether erg24 expression or activity changes at specific developmental time points could identify critical windows where sterol composition impacts developmental progression.

Studies could employ temperature-sensitive or inducible erg24 mutants to determine whether altering enzyme activity at specific developmental stages disrupts the multicellular developmental program.

How does the interaction between recombinant antibodies and erg24 facilitate structural and functional studies?

Recombinant antibodies (rAbs) against Dictyostelium discoideum erg24 can significantly advance structural and functional studies of this enzyme:

  • Protein detection and quantification: rAbs provide specific tools for Western blotting, ELISA, and immunoprecipitation assays to detect and quantify erg24 expression levels under various conditions .

  • Subcellular localization: Immunofluorescence microscopy using rAbs can determine the precise subcellular localization of erg24, expected to be in the endoplasmic reticulum based on studies in other organisms .

  • Protein-protein interactions: rAbs can be used in co-immunoprecipitation assays to identify interaction partners of erg24, potentially revealing components of sterol biosynthesis complexes.

  • Conformational studies: Conformation-specific rAbs can detect structural changes in erg24 upon substrate binding or inhibitor interaction.

  • Crystallization chaperones: rAbs fragments (Fab, scFv) can serve as crystallization chaperones to facilitate structural determination of erg24 through X-ray crystallography.

  • Activity modulation: Some rAbs might modulate enzyme activity through binding to regulatory sites, providing insights into allosteric regulation mechanisms.

The development of recombinant antibody resources for the Dictyostelium community addresses the challenge of limited commercial availability of research tools for this model organism . Libraries of rAbs against Dictyostelium antigens, developed through hybridoma sequencing and phage display techniques, provide valuable and reliable tools for protein characterization .

What are the key unresolved questions regarding recombinant Dictyostelium discoideum erg24?

Despite advances in understanding sterol biosynthesis across various organisms, several key questions regarding Dictyostelium discoideum erg24 remain unresolved:

  • Essential nature: Is erg24 essential for viability in Dictyostelium, as observed in Aspergillus fumigatus (double mutant) , or non-essential as in Candida albicans ?

  • Paralog existence: Does Dictyostelium possess multiple erg24 homologs with redundant functions, similar to Aspergillus fumigatus ?

  • Developmental regulation: How is erg24 expression regulated during the Dictyostelium lifecycle, particularly during the transition from unicellular to multicellular forms?

  • Substrate specificity: Does Dictyostelium erg24 display substrate preferences or kinetic properties distinct from fungal homologs?

  • Interaction network: What proteins interact with erg24 in Dictyostelium, and how do these interactions influence enzyme activity and regulation?

  • Drug susceptibility: How does inhibition of erg24 affect Dictyostelium growth and development, and can this information inform antifungal drug development?

Addressing these questions will require integrative approaches combining molecular genetics, biochemistry, structural biology, and systems biology techniques.

What emerging technologies could advance research on recombinant Dictyostelium discoideum erg24?

Several emerging technologies hold promise for advancing research on recombinant Dictyostelium discoideum erg24:

  • Cryo-electron microscopy: This technique could reveal the high-resolution structure of erg24, particularly challenging for membrane-associated proteins that resist crystallization.

  • CRISPR-Cas9 genome editing: Advanced CRISPR techniques allow precise genetic manipulation, including conditional knockouts and endogenous tagging of erg24 in Dictyostelium.

  • Single-cell transcriptomics: This approach could reveal cell-to-cell variation in erg24 expression during development and under different environmental conditions.

  • Proximity labeling proteomics: Techniques like BioID or APEX2 fused to erg24 could identify proximal proteins in the native cellular environment.

  • Lipid mass spectrometry imaging: This technology could map the spatial distribution of sterols in Dictyostelium cells and multicellular structures.

  • Microfluidic devices: These could facilitate high-throughput screening of conditions affecting erg24 activity or inhibitor testing.

  • Artificial intelligence for protein structure prediction: Tools like AlphaFold2 could predict erg24 structure in the absence of experimental data, guiding functional studies and drug design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.