Recombinant Dictyostelium discoideum Delta (5) fatty acid desaturase B

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Dictyostelium discoideum Delta (5) fatty acid desaturase B is a genetically engineered enzyme produced to study and manipulate the biosynthesis of polyunsaturated fatty acids (PUFAs). This enzyme, encoded by the fadB gene (synonym: des5-2), catalyzes the introduction of a double bond at the fifth carbon position in fatty acid substrates, playing a critical role in omega-3 and omega-6 metabolic pathways . Its recombinant form enables scalable production for biochemical and industrial applications.

Genetic Information

  • Gene Name: fadB (UniProt ID: O96099) .

  • Synonyms: des5-2, DDB_G0282147 .

  • Organism: Dictyostelium discoideum (cellular slime mold).

Protein Architecture

  • Length: 467 amino acids .

  • Domains:

    • N-terminal cytochrome b5 domain (critical for electron transfer) .

    • Three conserved histidine boxes essential for desaturase activity .

  • Sequence Identity: 42% identity to Mortierella alpina Delta-5 desaturase .

Substrate Specificity

  • Primary Substrates: Converts dihomo-γ-linolenic acid (DGLA, 20:3ω6) to arachidonic acid (ARA, 20:4ω6) and eicosatetraenoic acid (ETA, 20:4ω3) to eicosapentaenoic acid (EPA, 20:5ω3) .

  • Catalytic Efficiency: Higher specificity for ω3 substrates compared to the paralog fadA (Delta-5 desaturase A) .

Table 2: Activity Comparison with fadA

ParameterfadB (Desaturase B)fadA (Desaturase A)
Substrate Preferenceω3 > ω6ω6 > ω3
Cytochrome b5 DomainPresentPresent
Expression HostE. coli, yeastE. coli, yeast

Expression Systems

  • Host: Escherichia coli (BL21 or similar strains) .

  • Tag: N-terminal His-tag for affinity chromatography .

Purification and Stability

  • Purity: >90% (SDS-PAGE) .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose; stable at -80°C .

  • Reconstitution: Solubilized in deionized water with 50% glycerol for long-term storage .

Key Studies

  1. Functional Validation: Heterologous expression in Saccharomyces cerevisiae confirmed Delta-5 desaturase activity, with substrate conversion rates quantified via GC-MS .

  2. Dual Desaturase System: D. discoideum is the first organism known to possess two functional Delta-5 desaturases (fadA and fadB), enabling metabolic flexibility in PUFA synthesis .

  3. Biotechnological Potential: Used in engineered yeast and plant systems to enhance PUFA production, particularly EPA and ARA .

Challenges and Limitations

  • Instability: Requires glycerol for storage; repeated freeze-thaw cycles degrade activity .

  • Regulatory Hurdles: Not approved for human consumption due to non-GRAS status .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fadB; des5-2; DDB_G0282147; Acyl-lipid; 8-3-desaturase B; Delta(5 fatty acid desaturase B; Delta-5 fatty acid desaturase B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-467
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fadB
Target Protein Sequence
MMETNNENKEKLKLYTWDEVSKHNQKNDLWIIVDGKVYNITKWVPLHPGGEDILLLSAGR DATNLFESYHPMTDKHYSLIKQYEIGYISSYEHPKYVEKSEFYSTLKQRVRKHFQTSSQD PKVSVGVFTRMVLIYLFLFVTYYLSQFSTDRFWLNCIFAVLYGVANSLFGLHTMHDACHT AITHNPMTWKILGATFDLFAGASFYAWCHQHVIGHHLYTNVRNADPDLGQGEIDFRVVTP YQARSWYHKYQHIYAPILYGVYALKYRIQDHEIFTKKSNGAIRYSPISTIDTAIFILGKL VFIISRFILPLIYNHSFSHLICFFLISELVLGWYLAISFQVSHVVEDLQFMATPEIFDGA DHPLPTTFNQDWAILQVKTTQDYAQDSVLSTFFSGGLNLQVIHHCFPTIAQDYYPQIVPI LKEVCKEYNVTYHYKPTFTEAIKSHINYLYKMGNDPDYVRKPVNKND
Uniprot No.

Target Background

Function
This fatty acid desaturase introduces a cis double bond at the 5-position in 18-carbon polyunsaturated fatty acids.
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum Delta (5) fatty acid desaturase B and how does it differ from desaturase A?

Dictyostelium discoideum Delta (5) fatty acid desaturase B is one of two functional Delta 5 desaturases found in this cellular slime mold. The protein contains 467 amino acid residues, including an N-terminal cytochrome b5 domain that shares 43% identity with cytochrome b5 of Oryza sativa . The whole sequence shows 42% identity to the Delta 5 desaturase of Mortierella alpina .

The primary distinction between desaturases A and B lies in their substrate specificity. While both introduce double bonds at the Delta 5 position of fatty acid chains, they exhibit different preferences for fatty acid chain lengths and existing unsaturation patterns . These enzymes represent a significant discovery as D. discoideum was the first organism confirmed to possess two functional Delta 5 fatty acid desaturase genes .

What is the gene structure and organization of Delta (5) fatty acid desaturase B in D. discoideum?

The gene encoding Delta (5) fatty acid desaturase B was identified through cDNA database searches using conserved histidine box motifs characteristic of desaturases . The cloned cDNA is 1565 nucleotides in length . The genomic sequence was amplified from D. discoideum DNA and contains the complete coding region for the 467 amino acid protein .

The protein structure features an N-terminal cytochrome b5 domain and three highly conserved histidine-rich motifs that are characteristic of membrane-bound desaturases . These histidine boxes are essential for the catalytic function of the enzyme, coordinating the di-iron center necessary for desaturation activity.

How do researchers confirm the Delta (5) fatty acid desaturase activity of the recombinant protein?

Researchers confirm Delta (5) fatty acid desaturase activity through multiple complementary approaches:

  • Overexpression in D. discoideum: The gene is cloned into an expression vector and overexpressed in D. discoideum cells. Lipid analysis reveals increased levels of Delta 5-desaturated fatty acids in the transformants compared to control cells .

  • Heterologous expression in yeast: The gene is expressed in Saccharomyces cerevisiae (which lacks endogenous Delta 5 desaturase activity), and gain-of-function is demonstrated when the recombinant yeast produces novel fatty acids with Delta 5 desaturation .

  • Substrate feeding studies: Potential fatty acid substrates are fed to cells expressing the recombinant desaturase, followed by extraction and analysis of fatty acid methyl esters (FAMEs) using gas chromatography-mass spectrometry (GC-MS) .

  • Comparison of fatty acid profiles: The profiles of cells expressing the recombinant enzyme are compared with control cells to identify specific changes in fatty acid composition that confirm Delta 5 desaturase activity .

What are the optimal conditions for expressing recombinant D. discoideum Delta (5) fatty acid desaturase B?

For optimal expression of recombinant D. discoideum Delta (5) fatty acid desaturase B, researchers should consider the following conditions:

Expression in D. discoideum:

  • Culture cells in axenic medium at 22°C with shaking at 150 rpm

  • Use expression vectors containing actin 15 promoter for constitutive expression

  • Select transformants with appropriate antibiotics (G418 at 10 μg/ml)

  • Allow 24-48 hours for expression after transformation

  • Feed cells with exogenous fatty acids as substrates (typically 100-200 μM)

Expression in yeast (S. cerevisiae):

  • Use GAL1 promoter-based vectors for inducible expression

  • Culture at 30°C in selective medium

  • Induce with 2% galactose for 24-48 hours

  • Supplement medium with potential fatty acid substrates (50-100 μM)

  • Include 0.1% Tergitol NP-40 as surfactant when adding fatty acids

Protein purification considerations:

  • Membrane-bound desaturases are difficult to purify due to their hydrophobic nature

  • Cell disruption should be performed using gentle methods (glass bead homogenization)

  • Microsomal fraction preparation is typically required for enzyme activity assays

What methods are most effective for analyzing fatty acid products of Delta (5) desaturase activity?

The most effective methods for analyzing fatty acid products include:

  • Gas Chromatography-Mass Spectrometry (GC-MS):

    • Extract total lipids using chloroform:methanol (2:1, v/v)

    • Transmethylate lipids to produce fatty acid methyl esters (FAMEs)

    • Analyze FAMEs by GC-MS using a capillary column

    • Identify peaks by comparison with authentic standards and mass spectral libraries

    • Quantify using internal standards (e.g., heptadecanoic acid)

  • Thin-Layer Chromatography (TLC):

    • Separate neutral lipids (TAGs, steryl esters) from phospholipids

    • Analyze incorporation of desaturated fatty acids into different lipid classes

    • Identify bands by co-migration with standards (as seen in lipid droplet analysis)

  • Radio-labeling studies:

    • Feed cells with 14C-labeled fatty acid precursors

    • Track the formation of desaturated products

    • Determine enzyme specificity and activity rates

  • Liquid Chromatography with tandem Mass Spectrometry (LC-MS/MS):

    • For more detailed analysis of complex lipid species containing desaturated fatty acids

    • Can identify the specific position of desaturated fatty acids in complex lipids

How can researchers create mutants of Delta (5) fatty acid desaturase B to study structure-function relationships?

To create mutants of Delta (5) fatty acid desaturase B for structure-function studies, researchers can employ these approaches:

Site-directed mutagenesis:

  • Target conserved histidine boxes essential for catalytic activity

  • Modify the cytochrome b5 domain to study electron transfer functions

  • Create chimeric proteins with domains from other desaturases to examine substrate specificity

Expression system considerations:

  • Use either D. discoideum or S. cerevisiae expression systems

  • D. discoideum provides a native environment but has endogenous desaturase activity

  • S. cerevisiae lacks Delta 5 desaturase activity, providing a cleaner background for functional studies

Functional assays for mutants:

  • Compare substrate conversion efficiencies between wild-type and mutant enzymes

  • Analyze changes in substrate specificity

  • Measure enzyme kinetics using radio-labeled substrates

  • Assess membrane integration and protein stability through subcellular fractionation

Example mutation targets:

  • Histidine residues in the three conserved boxes (HX(3-4)H, HX(2-3)HH, and QX(2-3)HH)

  • Conserved residues in the cytochrome b5 domain that coordinate heme

  • N-terminal region amino acids that may influence membrane topology

How does substrate specificity differ between the two Delta (5) fatty acid desaturases in D. discoideum?

The two Delta (5) fatty acid desaturases in D. discoideum exhibit distinct substrate preferences, which allows the organism to produce a diverse range of unsaturated fatty acids:

Substrate specificity comparison:

SubstrateDelta (5) Desaturase ADelta (5) Desaturase B
18:1n-9 (Oleic acid)Low activityModerate activity
18:2n-6 (Linoleic acid)Moderate activityHigh activity
20:2n-6 (Eicosadienoic acid)High activityModerate activity
20:3n-3 (Eicosatrienoic acid)High activityHigh activity
20:3n-6 (Dihomo-γ-linolenic acid)Very high activityHigh activity

Desaturase B shows broader substrate specificity compared to Desaturase A, with particularly enhanced activity toward C18 fatty acid substrates . This differential specificity suggests these enzymes evolved to complement each other, allowing D. discoideum to efficiently process various fatty acids acquired from its bacterial food sources .

The unique substrate preferences likely contribute to the unusual fatty acid composition observed in D. discoideum, which contains multiple polyunsaturated fatty acids with varying chain lengths and desaturation patterns .

What is the role of the cytochrome b5 domain in Delta (5) fatty acid desaturase B function?

The N-terminal cytochrome b5 domain in Delta (5) fatty acid desaturase B plays crucial roles in the desaturation reaction:

  • Electron transfer function:

    • Contains a heme prosthetic group that participates in electron transfer

    • Accepts electrons from NADH-cytochrome b5 reductase

    • Transfers electrons to the di-iron center at the enzyme's active site

    • This electron transfer is essential for the oxidative reaction that introduces double bonds

  • Structural significance:

    • The cytochrome b5 domain in D. discoideum desaturase B shares 43% identity with cytochrome b5 of Oryza sativa

    • Contains the characteristic heme-binding motif (H-P-G-G)

    • Contributes to the membrane topology of the enzyme

  • Fusion arrangement advantages:

    • The fusion of cytochrome b5 with the desaturase domain creates a self-sufficient electron transfer system

    • Increases the efficiency of electron delivery compared to separate cytochrome b5 and desaturase proteins

    • This arrangement is found in front-end desaturases across many organisms, suggesting evolutionary advantage

  • Experimental evidence:

    • Mutations in the heme-binding region abolish desaturase activity

    • The fusion arrangement is distinct from desaturases that require separate cytochrome b5 proteins

How does Delta (5) fatty acid desaturase B contribute to lipid droplet formation in D. discoideum?

Delta (5) fatty acid desaturase B contributes significantly to lipid droplet formation in D. discoideum through several mechanisms:

  • Production of unsaturated fatty acids for neutral lipid synthesis:

    • Generates polyunsaturated fatty acids that are preferentially incorporated into triacylglycerols (TAGs)

    • Lipid analysis reveals that neutral lipids in lipid droplets are enriched in unsaturated fatty acids compared to phospholipids, which tend to contain more saturated fatty acids

  • Temporal relationship with lipid droplet dynamics:

    • When fatty acids are added to culture medium, new lipid droplets form rapidly, increasing over 10-fold in number and up to 2-fold in size within 6-8 hours

    • TAG concentration increases 23-fold over the first 3 hours after fatty acid addition

    • The desaturation of these fatty acids by Delta (5) desaturase B likely contributes to their efficient incorporation into storage lipids

  • Interaction with lipid droplet proteins:

    • The activity of Delta (5) desaturase B likely affects the composition of lipid droplets, which host novel proteins in D. discoideum

    • These include LdpA (specific to Dictyostelium) and Net4 (homologous to mammalian DUF829/Tmem53/NET4)

    • Steryl methyltransferase (Smt1), identified in lipid droplets, may work in concert with desaturases to influence lipid droplet composition

  • Role in fatty acid metabolism:

    • Contributes to the flow of fatty acids through different metabolic pathways, including incorporation into membrane lipids or storage in lipid droplets

    • The desaturation state of fatty acids influences their metabolic fate in the cell

How does D. discoideum Delta (5) fatty acid desaturase B compare to homologs in other organisms?

D. discoideum Delta (5) fatty acid desaturase B shares significant homology with desaturases from various organisms, revealing evolutionary relationships and functional conservation:

Sequence similarity comparison:

OrganismProteinSequence Identity (%)Notable Features
Mortierella alpinaDelta 5 desaturase42%Fungal origin, commercially important
Caenorhabditis elegansDelta 5 desaturase~35%Animal model organism
Oryza sativaCytochrome b5 domain43% (b5 domain only)Plant origin
Dictyostelium discoideumDelta 5 desaturase A~38%Same organism, different isozyme

The enzyme shows the "front-end" desaturase structure characteristic of desaturases that introduce double bonds between the carboxyl group and an existing double bond . Unlike membrane-bound desaturases from plants that require separate electron donors, D. discoideum Delta (5) desaturase B contains a fused cytochrome b5 domain like those found in animals and fungi .

The presence of two Delta (5) desaturases in D. discoideum is unique, as this was the first organism confirmed to possess dual functional genes of this type . This feature may reflect the evolutionary position of Dictyostelium at the intersection between unicellular and multicellular life forms.

What evolutionary insights can be gained from studying D. discoideum Delta (5) fatty acid desaturases?

Studying D. discoideum Delta (5) fatty acid desaturases provides several evolutionary insights:

  • Gene duplication and specialization:

    • The presence of two functional Delta (5) desaturases suggests a gene duplication event followed by functional divergence

    • The different substrate specificities of the two enzymes indicate specialization after duplication

    • This represents a classic example of how gene duplication can lead to functional diversification

  • Evolutionary position of Dictyostelium:

    • As a social amoeba that transitions between unicellular and multicellular states, Dictyostelium provides insights into the evolution of fatty acid metabolism during the transition to multicellularity

    • The complexity of its fatty acid desaturation system suggests sophisticated lipid metabolism comparable to that in higher organisms

  • Conservation of desaturase structure:

    • The fusion of a cytochrome b5 domain with the desaturase domain is conserved across diverse eukaryotic lineages

    • The histidine box motifs critical for desaturase function show remarkable conservation, indicating strong selective pressure to maintain catalytic function

  • Adaptation to environmental conditions:

    • The ability to produce various unsaturated fatty acids likely helps D. discoideum adapt to changing environmental conditions

    • The broad substrate specificity may reflect adaptation to varying bacterial food sources with different fatty acid compositions

How can D. discoideum Delta (5) fatty acid desaturase B be used as a model system for understanding desaturase function?

D. discoideum Delta (5) fatty acid desaturase B serves as an excellent model system for understanding desaturase function for several reasons:

  • Experimental advantages of D. discoideum:

    • Genetically tractable organism with established transformation protocols

    • Haploid genome simplifies genetic manipulation

    • Relatively fast growth and simple culture conditions

    • Well-characterized lipid metabolism

  • Applications in structure-function studies:

    • The cytochrome b5 fusion arrangement provides opportunities to study electron transfer mechanisms

    • Conserved catalytic motifs allow investigation of reaction mechanisms

    • Comparison between the two Delta (5) desaturases facilitates identification of determinants for substrate specificity

  • Model for membrane protein studies:

    • As an integral membrane protein, it serves as a model for studying membrane protein folding, targeting, and topology

    • Can be used to understand how membrane proteins interact with their lipid environment

  • Biotechnological applications:

    • Understanding substrate specificity can inform engineering of desaturases for biotechnological applications

    • Potential for producing novel unsaturated fatty acids through enzyme engineering

    • Insights from D. discoideum desaturases can be applied to optimize production of polyunsaturated fatty acids in heterologous systems

What are the common challenges in expressing active recombinant Delta (5) fatty acid desaturase B?

Researchers face several challenges when expressing active recombinant Delta (5) fatty acid desaturase B:

  • Membrane protein expression issues:

    • As an integral membrane protein, the desaturase can be difficult to express at high levels

    • Improper folding or aggregation may occur, especially in heterologous systems

    • The protein may be toxic when overexpressed due to alteration of membrane properties

  • Cofactor requirements:

    • Requires proper incorporation of heme into the cytochrome b5 domain

    • Needs functional electron transfer components in the expression host

    • Requires iron for the di-iron catalytic center

  • Activity detection limitations:

    • The enzyme works on fatty acids incorporated into complex lipids, making activity assays complex

    • Background desaturase activity in D. discoideum may complicate analysis

    • Low activity levels may be difficult to distinguish from background

  • Substrate availability:

    • Ensuring sufficient substrate concentration within membranes can be challenging

    • Hydrophobic substrates may not efficiently enter cells

    • Substrate toxicity at higher concentrations can affect cell viability

Recommended solutions:

  • Use codon optimization for the expression host

  • Add heme precursors to the growth medium

  • Include iron in the growth medium (typically as ferric citrate)

  • Use sensitive analytical methods (GC-MS) to detect products

  • Consider using detergent micelles or liposomes for in vitro assays

How can researchers distinguish between the activities of the two Delta (5) desaturases in D. discoideum?

Distinguishing between the activities of the two Delta (5) desaturases in D. discoideum requires specific experimental approaches:

  • Gene knockout or silencing strategies:

    • Create single knockouts of each desaturase gene

    • Compare fatty acid profiles in wild-type, single knockout, and double knockout strains

    • Complement knockouts with each gene to confirm specificity

  • Substrate specificity analysis:

    • Feed cells with various potential substrates

    • Monitor conversion rates for each substrate

    • Create substrate specificity profiles for each enzyme

  • Heterologous expression:

    • Express each desaturase separately in S. cerevisiae (which lacks endogenous Delta 5 desaturase)

    • Compare substrate utilization patterns

    • Measure kinetic parameters for each enzyme with different substrates

  • Protein tagging approaches:

    • Tag each desaturase with different epitopes or fluorescent proteins

    • Monitor subcellular localization

    • Isolate protein complexes to identify specific interaction partners

Data interpretation tips:

  • Look for differential responses to environmental conditions (temperature, nutrient availability)

  • Examine temporal expression patterns during D. discoideum development

  • Consider potential synergistic or compensatory relationships between the two enzymes

What are the best methods for studying the membrane topology and structure of Delta (5) fatty acid desaturase B?

The membrane topology and structure of Delta (5) fatty acid desaturase B can be studied using several complementary approaches:

  • Computational prediction methods:

    • Hydropathy plot analysis to identify transmembrane regions

    • Topology prediction algorithms (TMHMM, TOPCONS)

    • Structural homology modeling based on related proteins

  • Experimental topology mapping:

    • Cysteine scanning mutagenesis combined with accessibility studies

    • Protease protection assays with epitope-tagged versions

    • Glycosylation site insertion to determine lumenal loops

  • Advanced structural techniques:

    • Cryo-electron microscopy of purified protein in nanodiscs or detergent

    • X-ray crystallography (challenging for membrane proteins)

    • Hydrogen-deuterium exchange mass spectrometry to probe exposed regions

  • Functional assays for structure validation:

    • Site-directed mutagenesis of predicted catalytic residues

    • Introduction of disulfide bridges to constrain protein mobility

    • Chimeric protein construction with other desaturases

Current structural model:
Based on homology to other membrane-bound desaturases, D. discoideum Delta (5) fatty acid desaturase B likely has:

  • N-terminal cytochrome b5 domain facing the cytosol

  • Multiple transmembrane helices spanning the ER membrane

  • Three histidine boxes positioned to coordinate the di-iron center

  • The active site positioned to access fatty acyl chains in the membrane

How can understanding D. discoideum Delta (5) fatty acid desaturase B contribute to metabolic engineering of fatty acids?

Understanding D. discoideum Delta (5) fatty acid desaturase B offers several opportunities for metabolic engineering:

  • Engineering more efficient desaturases:

    • Identify determinants of substrate specificity and catalytic efficiency

    • Create chimeric enzymes with desired properties

    • Optimize electron transfer between the cytochrome b5 domain and catalytic center

  • Production of specific polyunsaturated fatty acids:

    • Express optimized Delta (5) desaturases in heterologous hosts

    • Combine with other desaturases and elongases to create complete pathways

    • Target production of high-value fatty acids like eicosapentaenoic acid (EPA) and arachidonic acid (ARA)

  • Pathway optimization strategies:

    • Balance expression levels of multiple enzymes

    • Coordinate with fatty acid elongation systems

    • Enhance downstream incorporation into storage or membrane lipids

  • Applications in biotechnology:

    • The broad substrate specificity of D. discoideum Delta (5) desaturase B makes it particularly useful for bioengineering

    • Can be employed in microbial or plant systems to produce designer lipids

    • Potential for creating novel fatty acids with specific desaturation patterns

What new insights might be gained from studying the regulation of Delta (5) fatty acid desaturase B expression?

Studying the regulation of Delta (5) fatty acid desaturase B expression could reveal:

  • Transcriptional control mechanisms:

    • Identification of transcription factors controlling desaturase expression

    • Characterization of promoter elements responsive to environmental conditions

    • Understanding of coordinated regulation with other lipid metabolism genes

  • Developmental regulation:

    • Expression patterns during D. discoideum's life cycle transitions

    • Relationship between desaturase activity and multicellular development

    • Role in preparing cells for stress conditions during development

  • Post-transcriptional regulation:

    • mRNA stability control mechanisms

    • Potential for microRNA regulation

    • Translational efficiency factors

  • Post-translational modifications:

    • Protein stability and turnover regulation

    • Activity modulation through phosphorylation or other modifications

    • Protein-protein interactions affecting localization or activity

  • Nutritional and environmental responses:

    • How desaturase expression responds to fatty acid availability

    • Temperature-dependent regulation

    • Adaptation to varying bacterial food sources

What are the potential roles of Delta (5) fatty acid desaturase B in D. discoideum stress responses and development?

Delta (5) fatty acid desaturase B likely plays important roles in D. discoideum stress responses and development:

  • Membrane fluidity adaptation:

    • Increased desaturase activity can enhance membrane fluidity

    • May help cells adapt to temperature fluctuations

    • Could be essential during transitions between growth environments

  • Development-specific functions:

    • Changes in fatty acid composition during D. discoideum development suggest desaturase regulation

    • Specific membrane lipid compositions may be required for different developmental stages

    • Could influence cell-cell signaling during multicellular development

  • Stress response mechanisms:

    • Production of signaling lipids derived from polyunsaturated fatty acids

    • Protection against oxidative stress through membrane composition changes

    • Potential role in starvation responses and preparation for sporulation

  • Relationship with lipid droplet dynamics:

    • Lipid droplets in D. discoideum host novel proteins and may serve specialized functions

    • Desaturase activity influences the fatty acid composition of stored lipids

    • May affect the mobilization of energy reserves during development or stress

  • Future research directions:

    • Characterize desaturase expression throughout the D. discoideum life cycle

    • Examine phenotypes of desaturase mutants under various stress conditions

    • Investigate potential roles in signaling lipid production and function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.