Recombinant Dictyostelium discoideum Diacylglycerol O-acyltransferase 2 (dgat2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dgat2; DDB_G0290279; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
dgat2
Target Protein Sequence
MVRFVPWNVPLYRRLETMAVAIYAMVLPVCLIMAFNLIVIPLFWGIAIPYLVWMFYFDTK HESGGRRVSLVRNSILWRYFRDYFPISLIINSNYDPKKNYIFAYHPHGIISIGAFCNFAT NANNIDEKLPGLKVHLLTLESNFKIPFLRDVLMSFGMSSVSKKSCENILNSGAGESICLV VGGAEESLDARPGLNEITLKKRKGFIKLALVNGASLVPVYSFGENDIYDQVPNPRGSLVR KIQTKIKDLTGIAPPLFMGRGIFNYDFGLLPVRHKIVTVVGEPIDIPKIKSPTDQVIEHY HQIYVEALQNLFDKHKNSCADKETGNLKIN
Uniprot No.

Target Background

Function

This protein catalyzes the terminal and rate-limiting step in triacylglycerol synthesis, utilizing diacylglycerol and fatty acyl-CoA as substrates. It is essential for storage lipid biosynthesis.

Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of Dictyostelium discoideum dgat2?

Dictyostelium discoideum dgat2 is an enzyme that catalyzes the formation of triacylglycerol (TAG), the common energy storage molecule. This process occurs through the esterification of diacylglycerol with a coenzyme A-activated fatty acid. Dgat2 in D. discoideum is specialized for TAG synthesis, similar to mammalian DGAT2 enzymes. While both dgat1 and dgat2 contribute to TAG formation in D. discoideum, dgat2 plays a comparatively smaller role than dgat1, which is opposite to the situation observed in mammalian cells .

Where is D. discoideum dgat2 localized within the cell?

D. discoideum dgat2 is primarily localized to lipid droplets within the cell. This subcellular localization is similar to that observed in mammals and yeast. In contrast, the dgat1 enzyme in D. discoideum localizes to the endoplasmic reticulum (ER). This differential localization suggests distinct functional roles for these two enzymes in TAG biosynthesis and may influence their access to different substrate pools .

What mechanisms underlie substrate specificity in D. discoideum dgat2?

The substrate specificity of DGAT2 enzymes appears to be significantly influenced by transmembrane regions near the N-terminus of the protein. Studies with chimeric DGAT2 enzymes from various species have shown that swapping these transmembrane regions can alter acyl-CoA specificity. While this has not been directly tested with D. discoideum dgat2, alignment studies and predictions suggest that plant and protist DGAT2 enzymes commonly contain two closely situated transmembrane helices in the first third of their amino acid sequence that may determine substrate preferences .

Research investigating D. discoideum dgat2 substrate specificity would likely benefit from examining these potential transmembrane regions and conducting substrate preference assays using various acyl-CoA donors and diacylglycerol acceptors. Creating chimeric enzymes between D. discoideum dgat2 and DGAT2 from other species could provide valuable insights into the structural determinants of substrate specificity.

How can recombinant D. discoideum dgat2 be effectively expressed in heterologous systems?

Recombinant expression of D. discoideum dgat2 can be achieved in heterologous systems such as Saccharomyces cerevisiae, particularly in TAG-deficient mutants like H1246. Expression vectors containing galactose-inducible promoters (e.g., pESC-URA or pYes2) have been successfully used for DGAT2 expression in yeast. For optimal expression:

  • Clone the full-length D. discoideum dgat2 gene into an appropriate expression vector

  • Transform yeast cells using the PEG/lithium acetate method

  • Select transformants based on appropriate selection markers (e.g., uracil prototrophy)

  • Grow transformants in medium containing raffinose before induction

  • Induce expression with galactose-containing medium

  • Harvest cells after 48 hours for TAG analysis and microsome isolation

For plant expression systems, strong seed-specific promoters have been utilized for DGAT2 expression, which could be adapted for D. discoideum dgat2 expression in plants if studying its impact on seed oil composition is of interest .

What are the critical functional domains in D. discoideum dgat2 and how do they compare to other DGAT2 enzymes?

D. discoideum dgat2 shares homology with DGAT2 enzymes from various organisms, with particularly strong similarity (45-50% identity) to DGAT2 from the marine protist Thraustochytrium aureum. Like other DGAT2 enzymes, D. discoideum dgat2 likely contains conserved motifs in its carboxyl-terminal half that contribute to catalytic activity .

Based on analysis of other DGAT2 enzymes, D. discoideum dgat2 is predicted to contain:

  • Two closely situated transmembrane helices near the N-terminus

  • Conserved catalytic residues in the C-terminal region

  • Cytosolic orientation of both N and C termini

A key area for further research would be mapping these domains in D. discoideum dgat2 specifically and determining their functional significance through site-directed mutagenesis and activity assays .

How does the enzymatic activity of D. discoideum dgat2 compare with dgat1 in terms of kinetic parameters?

While the search results don't provide specific kinetic parameters for D. discoideum dgat2 versus dgat1, they do indicate that dgat1 provides the predominant activity in TAG synthesis. A comprehensive enzymatic characterization of recombinant D. discoideum dgat2 would include:

ParameterMeasurement ApproachExpected Findings
VmaxRadiolabeled acyl-CoA assays with varying substrate concentrationsLikely lower for dgat2 than dgat1 based on physiological data
Km for acyl-CoAVarying acyl-CoA concentrations with fixed DAGMay differ between dgat1 and dgat2, reflecting their differential roles
Km for DAGVarying DAG concentrations with fixed acyl-CoACould reveal preferences for different DAG molecular species
Substrate preferencesComparative activity with different acyl-CoA and DAG speciesdgat2 likely specialized for TAG synthesis with narrower substrate range than dgat1
pH optimumActivity assays at varying pHImportant for optimizing in vitro assay conditions
Temperature stabilityActivity after incubation at different temperaturesRelevant for heterologous expression and purification strategies

These parameters would provide valuable insights into the biochemical differences between dgat1 and dgat2 that underlie their different physiological roles .

How can functional D. discoideum dgat2 be verified in recombinant expression systems?

Verification of functional D. discoideum dgat2 expression can be achieved through multiple complementary approaches:

  • Genetic complementation: Express D. discoideum dgat2 in a TAG-deficient yeast strain (e.g., S. cerevisiae H1246) and confirm restoration of TAG synthesis capacity .

  • Enzymatic activity assays: Isolate microsomes from recombinant cells and perform DGAT activity assays using:

    • 0.2M Tris HCl (pH 7.4) buffer

    • 60mM MgCl₂

    • 40mM DTT

    • 120mM sucrose

    • 0.02mM [1-¹⁴C]acyl-CoA

    • 0.4mM DAG

    • 20 μg of microsomal protein

    Reactions are typically incubated for 10 minutes at 30°C and stopped with heptane/isopropanol (3:2, v/v) .

  • TAG analysis: Extract lipids from recombinant cells and analyze TAG content and composition using thin-layer chromatography or liquid chromatography-mass spectrometry.

  • Protein expression verification: Confirm protein expression using Western blotting with antibodies against the recombinant protein or an epitope tag if incorporated.

  • Subcellular localization: Create GFP-tagged versions of dgat2 to verify proper localization to lipid droplets using fluorescence microscopy .

What approaches are useful for creating D. discoideum dgat2 knockout mutants?

Creation of D. discoideum dgat2 knockout mutants can be accomplished through homologous recombination. The methodology involves:

  • Construction of a knockout vector:

    • Amplify the dgat2 gene from D. discoideum genomic DNA

    • Clone into an appropriate vector (e.g., pGEM-T Easy)

    • Insert a selection marker (e.g., blasticidin resistance cassette) within the coding sequence

    • Ensure sufficient flanking sequences for homologous recombination (typically several hundred base pairs on each side)

  • Transformation:

    • Digest the construct to release the disruption fragment

    • Electroporate the linear fragment into D. discoideum cells

    • Select transformants using appropriate antibiotics

  • Screening:

    • Verify gene disruption by PCR using primers that bind outside the targeting sequence and within the selection marker

    • Confirm absence of mRNA expression by RT-PCR

    • Confirm absence of protein by Western blotting if antibodies are available

  • Phenotypic characterization:

    • Analyze TAG content and composition

    • Assess growth characteristics, particularly on bacterial lawns

    • Evaluate lipid droplet formation and dynamics

What methods can be used to analyze substrate specificity of D. discoideum dgat2?

Analysis of D. discoideum dgat2 substrate specificity can be approached through several methods:

  • In vitro enzyme assays using purified microsomes containing recombinant dgat2:

    • Test various acyl-CoA donors (varying in chain length and saturation)

    • Test different DAG molecular species as acceptors

    • Quantify product formation using radiolabeled substrates

    • Compare relative activities with different substrate combinations

  • Chimeric enzyme construction:

    • Create chimeric enzymes with regions from DGAT2s with known different specificities

    • Focus particularly on predicted transmembrane regions and other potential substrate-binding domains

    • Express in appropriate hosts and assess altered specificities

    • This approach has successfully identified regions critical for substrate specificity in plant DGAT2 enzymes

  • Site-directed mutagenesis:

    • Target conserved residues predicted to be involved in substrate binding

    • Create point mutations and assess impacts on substrate preferences

    • Systematic mutation of residues in predicted transmembrane regions may be particularly informative

  • In vivo complementation assays:

    • Express D. discoideum dgat2 in organisms engineered to produce unusual fatty acids

    • Analyze TAG composition to determine incorporation of these fatty acids

    • Compare with other DGAT enzymes with known specificity profiles

How can GFP-tagged D. discoideum dgat2 constructs be generated for localization studies?

GFP-tagged D. discoideum dgat2 constructs can be generated through the following procedural steps:

  • N-terminal GFP fusion:

    • Amplify the dgat2 gene using primers with appropriate restriction sites (e.g., EcoRI)

    • Clone into a vector containing GFP positioned for N-terminal fusion

    • Ensure the reading frame is maintained between GFP and dgat2

    • The resulting construct will express GFP-Dgat2 fusion protein

  • C-terminal GFP fusion:

    • Amplify dgat2 with primers that remove the stop codon and add appropriate restriction sites

    • Clone into a vector designed for C-terminal GFP fusion

    • Verify correct reading frame

    • The resulting construct will express Dgat2-GFP fusion protein

  • Expression in D. discoideum:

    • Transform constructs into wild-type or dgat2 knockout D. discoideum

    • Select transformants using appropriate resistance markers (e.g., G418)

    • Isolate individual clones by spreading dilutions on bacterial lawns

    • Verify expression by fluorescence microscopy and Western blotting

  • Localization analysis:

    • Examine subcellular localization by fluorescence microscopy

    • Use lipid droplet-specific dyes (e.g., BODIPY or Nile Red) for co-localization studies

    • Consider co-expression with ER markers to distinguish from dgat1 localization

    • Perform time-lapse imaging to study dynamics during lipid droplet formation

How does D. discoideum dgat2 compare to DGAT2 enzymes from other species in functional complementation assays?

Functional complementation assays provide valuable insights into the evolutionary conservation and functional divergence of DGAT2 enzymes. When comparing D. discoideum dgat2 with other DGAT2 enzymes:

This comparative approach could reveal evolutionary adaptations in DGAT2 function across diverse organisms and provide insights into the structural determinants of these functional differences.

What can be learned from evolutionary analysis of D. discoideum dgat2 compared to other DGAT2 sequences?

Evolutionary analysis of D. discoideum dgat2 in relation to other DGAT2 sequences can provide valuable insights:

  • D. discoideum dgat2 shows significant homology (45-50% identity) to DGAT2 from Thraustochytrium aureum, a marine protist, suggesting potential evolutionary relationships between these organisms' lipid metabolism pathways .

  • Alignment and prediction of transmembrane helices across plant and protist DGAT2 enzymes reveal a consensus pattern of two closely situated transmembrane helices near the N-terminus, indicating evolutionary conservation of this structural feature despite sequence divergence in other regions .

  • Key research questions for evolutionary analysis include:

    • How conserved are the catalytic domains across evolutionary diverse DGAT2 enzymes?

    • Do differences in substrate specificity correlate with phylogenetic clustering?

    • Are there lineage-specific insertions or deletions that might explain functional differences?

    • How does the evolutionary history of DGAT1 and DGAT2 compare, given their different roles across species?

  • Molecular phylogenetic analysis combined with functional studies of recombinant enzymes could help reconstruct the evolutionary history of TAG synthesis pathways and identify key adaptations in different lineages.

What are the major challenges in purifying active recombinant D. discoideum dgat2?

Purification of active recombinant D. discoideum dgat2 presents several challenges and potential solutions:

ChallengeExplanationPotential Solutions
Membrane protein isolationAs a transmembrane protein localized to lipid droplets, dgat2 is inherently difficult to solubilize while maintaining activityUse mild detergents optimized for lipid droplet proteins; consider nanodisc technology for maintaining native lipid environment
Low expression levelsMembrane proteins often express poorly in heterologous systemsOptimize codon usage; use strong inducible promoters; consider specialized host systems like Pichia pastoris
Verification of activityTraditional purification steps may disrupt enzymatic activityDevelop assays to monitor activity during purification; consider partial purification approaches that maintain function
Protein stabilityMembrane proteins may be unstable when removed from lipid environmentInclude appropriate lipids during purification; optimize buffer conditions; consider fusion tags that enhance stability
AggregationHydrophobic transmembrane regions can cause aggregationScreen different detergents and solubilizing agents; optimize protein concentration and buffer conditions

Researchers working with D. discoideum dgat2 might consider focusing on microsomal preparations rather than fully purified protein, as these maintain the native membrane environment and typically preserve enzymatic activity .

How can contradictory results in dgat2 functional studies be reconciled?

When encountering contradictory results in dgat2 functional studies, researchers should consider several factors that might explain the discrepancies:

  • Expression system differences: Different heterologous expression systems (yeast, insect cells, plant systems) may provide different cellular environments that affect dgat2 folding, localization, and activity.

  • Assay conditions: Variations in assay conditions (pH, temperature, cofactors, substrate concentrations) can significantly impact measured enzymatic activities.

  • Protein modifications: Post-translational modifications may differ between expression systems and affect enzyme function.

  • Substrate availability: Access to substrates may be limited by cellular compartmentalization or competition with endogenous enzymes.

  • Fusion tags and constructs: Different fusion constructs (N-terminal vs. C-terminal tags, different linker sequences) may affect protein folding and function.

To reconcile contradictory results:

  • Directly compare different expression systems using identical dgat2 constructs

  • Standardize assay conditions across laboratories

  • Validate activity measurements using multiple complementary approaches

  • Consider the impact of cellular context on enzyme function

  • Examine substrate accessibility in different systems

This systematic approach can help distinguish genuine functional differences from methodological artifacts .

What are promising applications of recombinant D. discoideum dgat2 in lipid biotechnology?

Recombinant D. discoideum dgat2 offers several promising applications in lipid biotechnology:

Future research should explore these applications while addressing the technical challenges associated with expressing and studying membrane-bound enzymes like dgat2.

What is the potential for creating modified D. discoideum dgat2 with enhanced or altered activity?

The potential for creating modified D. discoideum dgat2 with enhanced or altered activity is significant, based on insights from studies of other DGAT2 enzymes:

These modifications could be achieved through rational design based on sequence comparisons, random mutagenesis and screening, or directed evolution approaches. The unique properties of D. discoideum dgat2 make it an interesting target for such protein engineering efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.