Recombinant Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (ost2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges will apply for dry ice shipping.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ost2; DDB_G0291049; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; Oligosaccharyl transferase subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
ost2
Target Protein Sequence
MSTTASTSSNNLTFTSIVKSFFESYSKTPQKLKIIDLFLIYTFITGVIVFTYCCLVGTYP
FNSFLAAFISTVGCFVLTVCLRIQINPINNFGKTISIERAFTDYLLCNLILHLVVFNFLG
Uniprot No.
Target Background
Function
This protein is a subunit of the oligosaccharyltransferase (OST) complex. The OST complex catalyzes the transfer of a specific glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in N-glycosylation. N-glycosylation is a co-translational process, and the OST complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER) membrane. All subunits of the OST complex are necessary for optimal enzymatic activity.
Database Links
KEGG: ddi:DDB_G0291049
STRING: 44689.DDB0233175
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
