Recombinant Dictyostelium discoideum Dolichyldiphosphatase 1 (dolpp1)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics and Production

Recombinant dolpp1 is synthesized as a full-length protein (1–229 amino acids) fused with an N-terminal His tag for purification . Key specifications include:

ParameterValue
Source OrganismDictyostelium discoideum
Expression HostE. coli
TagHis-Tag
Protein LengthFull-length (1–229 amino acids)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%)

The recombinant protein retains enzymatic activity, enabling its use in studies of glycosylation pathways .

Functional Insights and Pathway Involvement

Dolpp1 functions as a dolichyldiphosphatase, catalyzing the hydrolysis of dolichyldiphosphate to dolichol and phosphate. This reaction is pivotal in recycling dolichol, a lipid anchor required for N-glycan biosynthesis .

Key Pathway and Interactions

PathwayRelated Proteins
N-Glycan BiosynthesisSTT3A (oligosaccharyltransferase), MGAT4B (N-acetylglucosaminyltransferase), DPAGT1 (N-acetylglucosamine-phosphotransferase)

Dolpp1 interacts with components of the endoplasmic reticulum, ensuring efficient lipid-linked oligosaccharide synthesis. Its absence or dysfunction could disrupt glycoprotein quality control .

Research Applications and Availability

Recombinant dolpp1 is widely used in:

  • Glycosylation Studies: Investigating lipid-linked oligosaccharide metabolism.

  • Enzyme Kinetics: Assessing substrate specificity and inhibitor interactions.

  • Protein Engineering: Modifying catalytic residues to study structure-function relationships.

The protein is commercially available through specialized vendors, such as Creative BioMart, in lyophilized form for academic and industrial research .

Table 2: Pathway Proteins

ProteinFunction
STT3ACatalyzes N-linked glycosylation in the ER.
MGAT4BAdds N-acetylglucosamine to Man5GlcNAc2.
DPAGT1Initiates N-glycosylation by transferring GlcNAc-P to dolichol.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
dolpp1; DDB_G0274591; Dolichyldiphosphatase 1; Dolichyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
dolpp1
Target Protein Sequence
MEQEVYTALTFVELTTVHYQHDDPFGLFNAYVTLIPIAIAIGVITLILFRRDVRTISIFL GLLFSECTNYVLKKSIKEHRPTMWKELRKQSYGMPSSHSQFMFFFAVLMTLFYLKKRIRF GSKILPIISVTFLFFLAAGVAYSRVHLYYHTAKQVFCGSFIGICLGFIWYGVIEYIFRPY LFPIIINHPIGKYFYLRDSSEIEDLLNFEYTNVMNKVKTINKTKPIKTK
Uniprot No.

Target Background

Function
Dolichyldiphosphatase 1 (dolpp1) is essential for efficient N-glycosylation. It plays a crucial role in maintaining optimal levels of dolichol-linked oligosaccharides. This enzyme exhibits a high rate of hydrolysis for dolichyl pyrophosphate and a much lower rate for dolichyl monophosphate. It does not act on phosphatidate.
Database Links
Protein Families
Dolichyldiphosphatase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Dolichyldiphosphatase 1 (dolpp1) and what is its role in Dictyostelium discoideum?

Dolichyldiphosphatase 1 (dolpp1) is an integral membrane enzyme responsible for the dephosphorylation of dolichyl diphosphate in the dolichol cycle. In Dictyostelium discoideum, this 229-amino acid protein (UniProt ID: Q86IX2) plays a crucial role in glycosylation pathways by recycling dolichyl carriers . The enzyme supports the cellular machinery that generates complex post-translational modifications of proteins and lipids, which are essential for various cellular functions including cellular recognition, signaling, and structural integrity .

How does dolpp1 relate to the broader dolichol metabolic pathway?

Dolpp1 functions within the dolichol cycle, which is integral to glycosylation pathways across eukaryotes. The enzyme acts downstream of cis-prenyltransferases (cis-PTases) that synthesize dehydro-dolichyl diphosphate through the sequential elongation of farnesyl pyrophosphate (FPP) with isopentenyl pyrophosphate (IPP) units . After dephosphorylation by dolpp1, dolichol undergoes further processing including phosphorylation by CTP-dependent dolichyl kinase (like Sec59p) to enter the glycosylation pathway, where dolichyl phosphates serve as membrane-anchored carbohydrate carriers for glycosyltransferases .

What are the optimal conditions for expression and purification of recombinant dolpp1?

For successful expression and purification of recombinant dolpp1:

  • Expression System: The protein can be efficiently expressed in E. coli systems with an N-terminal His-tag for purification purposes .

  • Purification Protocol:

    • Use affinity chromatography (Ni-NTA or similar) for initial capture

    • Achieve >90% purity using appropriate SDS-PAGE verification

    • Consider detergent inclusion during purification to maintain solubility of this membrane protein

  • Storage Recommendations:

    • Store lyophilized powder at -20°C/-80°C

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term stability

    • Aliquot to avoid repeated freeze-thaw cycles which can compromise activity

How can dolichyl phosphates be effectively quantified in experimental systems?

A novel approach for quantitative analysis of dolichyl phosphates includes:

  • Sample Preparation: Extraction of lipids from biological membranes using appropriate solvent systems that efficiently recover phospholipids.

  • Phosphate Methylation: Treatment with trimethylsilyl diazomethane to derivatize the phosphate groups, which enhances detection sensitivity.

  • RPLC-MS Analysis: Separation via reverse-phase liquid chromatography followed by mass spectrometry detection.

  • Fragmentation Analysis: The protonated dimethylphosphate head group fragment ion [HPO₂(OCH₃)₂ + H]⁺ serves as a characteristic marker for methylated dolichyl phosphates in MS/MS spectra with low normalized collision energy (NCE 10%) .

This methodology allows simultaneous qualitative and quantitative assessment of dolichyl phosphate species with different isoprene chain lengths, which is crucial for research involving dolpp1 function .

What methods can be used to assess the enzymatic activity of dolpp1?

Enzyme activity assays for dolpp1 can utilize several approaches:

  • Radiolabeled Substrate Method:

    • Incubate purified dolpp1 with radiolabeled dolichyl diphosphate

    • Separate reaction products using reverse-phase HPTLC plates

    • Quantify conversion via autoradiography and liquid scintillation counting

  • Mass Spectrometry-Based Assay:

    • Utilize the phosphate methylation approach described in search result

    • Monitor the conversion of dolichyl diphosphate to dolichyl phosphate

    • Quantify relative abundances of substrate and product

  • Coupled Enzyme Assays:

    • Design system where dolpp1 activity is linked to detection of released phosphate

    • Use appropriate phosphate-detection colorimetric methods

Assay TypeAdvantagesLimitationsSensitivity
RadiolabeledHigh sensitivity, direct quantificationRequires radioactive handling, special permitsVery high (pmol range)
MS-basedNo radioactivity, multiple species detectedExpensive equipment, complex analysisHigh (low pmol range)
Coupled colorimetricSimple equipment, rapid resultsIndirect measurement, potential interferenceModerate (nmol range)

How can genetic manipulation of dolpp1 inform our understanding of glycosylation pathways?

Genetic manipulation strategies for dolpp1 research include:

  • Gene Knockout/Knockdown Approaches:

    • CRISPR-Cas9 deletion or RNAi knockdown of dolpp1

    • Analysis of resultant glycosylation defects using glycoprotein analysis techniques

    • Comparison to known glycosylation disorders in other systems

  • Temperature-Sensitive Mutants:

    • Similar to approaches used for Sec1 in Dictyostelium (sec1A1), temperature-sensitive dolpp1 mutants could be generated to study progressive loss of function

    • At permissive temperature (e.g., 22°C), cells maintain normal function

    • At restrictive temperature (e.g., 27.5°C), functional defects become apparent, allowing temporal control of dolpp1 activity

  • Hemizygous Models:

    • Creating strains with single-copy dolpp1 to study gene dosage effects

    • Analogous to studies on CWH8 in Candida albicans, where hemizygotes showed altered dolichol levels compared to homozygous knockouts

These approaches can reveal how dolpp1 function influences broader glycosylation pathways and subsequent cellular processes.

What phenotypic effects would dolpp1 mutations likely cause in Dictyostelium discoideum?

Based on comparative studies and information about related pathways:

How might dolpp1 function integrate with broader cellular stress responses?

The integration of dolpp1 with cellular stress responses likely occurs through:

  • ER Stress Pathways:

    • Impaired dolpp1 function could trigger unfolded protein response (UPR) due to glycosylation defects

    • Potential feedback mechanisms between ER stress sensors and dolichol pathway regulation

  • Membrane Homeostasis:

    • Dolichol species contribute to membrane fluidity and organization

    • Altered dolpp1 activity might affect membrane properties and stress tolerance

  • Metabolic Regulation:

    • Connection to broader isoprenoid pathways sharing precursors with dolichol synthesis

    • Potential regulatory crossover with cholesterol synthesis pathway components

Understanding these integrations could provide insights into how cells modulate glycosylation capacity under varying environmental conditions.

What are common challenges in working with recombinant dolpp1 and how can they be addressed?

Researchers frequently encounter several challenges when working with dolpp1:

  • Protein Solubility Issues:

    • Challenge: As a membrane protein, dolpp1 has hydrophobic domains that can cause aggregation

    • Solution: Include appropriate detergents (e.g., DDM, CHAPS) during purification; consider using membrane mimetics like nanodiscs or liposomes for functional studies

  • Activity Preservation:

    • Challenge: Loss of enzymatic activity during purification and storage

    • Solution: Add glycerol (5-50%) to storage buffer; avoid repeated freeze-thaw cycles; store as aliquots at -80°C

  • Expression Yield Optimization:

    • Challenge: Low expression levels in heterologous systems

    • Solution: Optimize codon usage for expression host; test different promoter strengths; consider fusion tags that enhance solubility (e.g., MBP, SUMO)

  • Assay Interference:

    • Challenge: Lipid substrates can form micelles or aggregate, affecting enzyme accessibility

    • Solution: Carefully optimize substrate delivery methods; consider mixed micelle approaches with appropriate detergents

How can researchers distinguish between direct dolpp1 effects and broader pathway perturbations?

To isolate dolpp1-specific effects:

  • Complementation Studies:

    • Generate dolpp1 mutants and then reintroduce wild-type or modified versions

    • Compare the ability of different constructs to rescue phenotypes

  • Pathway Intermediates Analysis:

    • Quantify multiple intermediates in the dolichol pathway

    • Create profiles of metabolite accumulation or depletion specific to dolpp1 disruption

    • Compare with profiles obtained from disrupting other pathway components

  • Inducible/Conditional Systems:

    • Use temperature-sensitive systems similar to those described for Sec1

    • Employ chemical induction systems to achieve temporal control of dolpp1 expression

  • Substrate Specificity Assays:

    • Test activity of dolpp1 against multiple potential substrates

    • Identify unique enzymatic signatures distinct from other phosphatases

What controls are essential when studying glycosylation impacts of dolpp1 manipulation?

Essential controls include:

  • Enzymatic Controls:

    • Heat-inactivated enzyme preparations

    • Catalytically inactive mutants (e.g., active site mutations)

    • Substrate-only and enzyme-only reactions

  • Genetic Controls:

    • Wild-type parental strains maintained under identical conditions

    • Heterozygous/hemizygous strains to assess gene dosage effects

    • Rescue strains expressing wild-type dolpp1 in knockout background

  • Specificity Controls:

    • Parallel analysis of other phosphatases to confirm specificity of observed effects

    • Measurement of multiple glycosylation pathways to identify dolpp1-specific impacts

  • Environmental Controls:

    • Consistent temperature maintenance (especially important in Dictyostelium systems)

    • Standardized growth media and conditions

    • Defined cell densities and growth phases for analysis

How might emerging analytical techniques enhance dolpp1 research?

Several cutting-edge approaches could advance dolpp1 research:

  • Advanced Mass Spectrometry Techniques:

    • Implementation of the phosphate methylation approach described for dolichyl phosphates

    • Application of ion mobility separation to better resolve isomeric dolichol species

    • Integration with global lipidomics analyses to understand broader metabolic contexts

  • Live-Cell Imaging Approaches:

    • Development of fluorescent dolichol analogs to track trafficking

    • FRET-based sensors to monitor dolpp1 activity in real-time

    • Super-resolution microscopy to localize dolpp1 within membrane subdomains

  • Computational Methods:

    • Molecular dynamics simulations of dolpp1-membrane interactions

    • Systems biology modeling of dolichol pathway flux

    • Machine learning approaches to predict impacts of dolpp1 variants

These techniques could provide unprecedented insights into the spatial and temporal dynamics of dolpp1 function within living cells.

What are potential translational applications of dolpp1 research?

Understanding dolpp1 function has several potential translational implications:

  • Congenital Disorders of Glycosylation (CDGs):

    • Insights from dolpp1 research could inform therapeutic approaches for CDGs

    • Potential for identifying small molecule modulators of dolichol pathway enzymes

  • Neurodegenerative Disease Connections:

    • Dolichol pathway perturbations have been associated with neurodegeneration

    • Understanding regulatory mechanisms might identify intervention points

  • Cancer Biology Applications:

    • Altered glycosylation is a hallmark of cancer cells

    • Targeting dolpp1 or related enzymes could potentially modulate cancer cell glycosylation patterns

  • Biotechnology Applications:

    • Engineering glycosylation pathways for optimized recombinant protein production

    • Controlling dolichol availability through dolpp1 modulation could enhance glycoprotein yields

What unexplored aspects of dolpp1 biology warrant further investigation?

Several knowledge gaps represent opportunities for future investigation:

  • Regulatory Mechanisms:

    • How is dolpp1 activity regulated in response to cellular needs?

    • Are there post-translational modifications that modulate enzyme function?

    • Do membrane composition changes affect dolpp1 activity?

  • Evolutionary Aspects:

    • How conserved is dolpp1 function across evolutionary diverse organisms?

    • Are there functional adaptations in dolpp1 orthologs related to species-specific glycosylation needs?

  • Integration with Cellular Signaling:

    • Does dolpp1 function respond to or influence cellular signaling pathways?

    • Could dolichol intermediates serve as signaling molecules themselves?

  • Development and Differentiation Roles:

    • How does dolpp1 function change during Dictyostelium development stages?

    • Are there tissue-specific or differentiation-stage-specific roles in multicellular models?

Addressing these questions could dramatically expand our understanding of this essential enzyme family and its broader biological context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.