Recombinant Dictyostelium discoideum Elongation of fatty acids protein A (eloA)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Gene and protein details:

  • Gene name: eloA (DDB_G0292896)

  • UniProt ID: Q54CJ4

  • Protein family: ELOVL-like elongase

  • Length: 301 amino acids (partial recombinant form)

  • Subcellular localization: Multi-pass transmembrane protein embedded in the endoplasmic reticulum membrane .

Mechanistic insights:

  1. Condensation reaction: Catalyzes the elongation of acyl-CoA using malonyl-CoA, forming a 3-ketoacyl-CoA intermediate .

  2. Covalent intermediates: Utilizes histidine residues (H150 and H181 in human ELOVL7 homolog) to form acyl-enzyme intermediates .

  3. Chain-length control: Non-conserved residues in the transmembrane tunnel regulate product length .

Experimental validation:

  • Site-directed mutagenesis of Dictyostelium EloA confirmed residues critical for catalytic activity .

  • Heterologous expression in Saccharomyces cerevisiae demonstrated elongation of 16:1 Δ9 to 18:1 Δ11 with >80% efficiency .

Recombinant Expression Systems

Production platforms:

Host SystemPurityYieldKey Advantages
E. coli≥85%ModerateCost-effective, rapid production
Yeast≥85%HighEukaryotic post-translational modifications
Baculovirus/insect cells≥85%HighSuitable for large-scale production

Purification:

  • Achieved via affinity chromatography, confirmed by SDS-PAGE .

Applications in Research and Biotechnology

Basic research:

  • Model enzyme for studying VLCFA synthesis in eukaryotes .

  • Tool to investigate metabolic diseases linked to fatty acid elongation (e.g., hepatic steatosis, Parkinson’s) .

Biotechnological potential:

  • Bioengineering: Used to produce unusual fatty acids (e.g., 18:1 Δ11) for industrial applications .

  • Drug discovery: Target for inhibitors in cancer and metabolic disorders .

Challenges and Future Directions

  • Limitations: Low solubility in recombinant forms complicates structural studies .

  • Opportunities:

    • Engineering EloA variants for tailored fatty acid production .

    • Development of high-throughput assays for inhibitor screening .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
eloA; DDB_G0292896; Elongation of fatty acids protein A; 3-keto acyl-CoA synthase eloA; Fatty acid elongase A; Very-long-chain 3-oxoacyl-CoA synthase A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
eloA
Target Protein Sequence
MEHIHDINFQEFSKDPIGTIDRFRWKNEVTPFSNILFPIVCSFGYLALIYGLQIFMKNKK EIKLHGFAMFHNLFLCLLSLLMFLGIVIPMAKYSFPHGLYNIICKPIDSGLVQFSYYIFY LSKVYEFIDTIIQVLRKKSLLFLHVWHHFITLWLVWANLKYDTGCQWVDISANCFVHIVM YFYYFQTERGINPWWKKHITTCQIIQFIVDMSSHLAWHFYDTQGNHNSNYCSGTWATSAF SDFVILSFLGLFIQFFVKAYKKKSSIKKKTN
Uniprot No.

Target Background

Function
Recombinant Dictyostelium discoideum Elongation of fatty acids protein A (eloA) is a fatty acid elongase with high substrate specificity for monounsaturated fatty acids, particularly 16:1 (Δ-9), which it elongates to produce the unusual 18:1 (Δ-11) fatty acid.
Gene References Into Functions
  1. The D. discoideum ELOA elongase exhibits unique substrate specificity, elongating 16:1 Δ-9 to 18:1 Δ-11 fatty acids. PMID: 18621026
Database Links
Protein Families
ELO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biological role of eloA in D. discoideum fatty acid metabolism?

Elongation of fatty acids protein A (eloA) in Dictyostelium discoideum plays a crucial role in the extension of fatty acid carbon chains, which is essential for proper lipid metabolism. This protein functions within the broader context of fatty acid biosynthesis pathways in this model organism. D. discoideum has been extensively studied as a valuable model for numerous aspects of eukaryotic cell biology, including cell motility, adhesion, and host-pathogen interactions .

Within the fatty acid metabolism pathway, eloA likely works in concert with other proteins such as FcsA, which is responsible for activating fatty acids by adding a coenzyme A moiety that renders them competent to enter lipid metabolism . The activated fatty acids can then be processed by elongation proteins like eloA to generate longer-chain fatty acids required for various cellular functions.

How does eloA expression change during the D. discoideum life cycle?

Based on patterns observed with related fatty acid metabolism genes in D. discoideum, eloA expression likely varies throughout the organism's developmental stages. Similar proteins involved in fatty acid metabolism, such as the fatty acid activating enzyme FcsA, show specific expression patterns that correlate with developmental progression .

The expression of genes related to lipid metabolism appears to be carefully regulated during D. discoideum development. For instance, genes like Steely1 (stlA) are expressed maximally in early development before cellular aggregation, while Steely2 (stlB) is expressed later in development . By analogy, eloA expression may follow a specific temporal pattern that aligns with the changing metabolic needs of the organism during its life cycle.

What is the relationship between eloA and lipid droplet formation?

Elongation of fatty acids protein A likely influences lipid droplet formation in D. discoideum through its role in fatty acid processing. Research has shown that D. discoideum cells can accumulate storage fat from added fatty acids, forming visible lipid droplets within 3 hours of exposure to fatty acids like palmitic acid .

Interestingly, D. discoideum cells containing abundant lipid droplets show developmental defects, with many cells unable to proceed through development when starved . This suggests that proper regulation of fatty acid elongation through proteins like eloA may be critical for normal development. Mutants deficient in genes of fat metabolism, such as fcsA, dgat1, and dgat2, show altered lipid droplet formation and developmental patterns .

What recombinant antibody techniques are suitable for studying eloA?

Recombinant antibodies provide valuable tools for studying proteins like eloA in D. discoideum. Recent advances in recombinant antibody technology have expanded the toolbox available to Dictyostelium researchers. Using hybridoma sequencing and phage display techniques, researchers have generated panels of recombinant antibodies against various D. discoideum antigens .

For studying eloA specifically, researchers could adapt these approaches to generate specific recombinant antibodies that would enable:

  • Immunofluorescence labeling for subcellular localization studies

  • Western blot analysis for expression level quantification

  • Immunoprecipitation for protein-protein interaction studies

  • Flow cytometry for cell population analysis

These recombinant antibodies offer advantages over traditional mono- and polyclonal antibodies, as they provide unlimited renewable sources of consistent reagents that can be shared across the research community .

What genetic manipulation strategies are most effective for studying eloA function?

Based on successful approaches with related genes, several genetic manipulation strategies would be effective for studying eloA function:

  • Gene disruption/knockout: Similar to the approach used for steely genes (stlA and stlB), researchers can disrupt the eloA gene by inserting plasmids into the coding region . This allows for analysis of the loss-of-function phenotype.

  • Fluorescent protein tagging: Expressing eloA fused to GFP or RFP allows for visualization of protein localization and dynamics during different developmental stages or in response to fatty acid treatment .

  • Inducible expression systems: Creating strains with controllable eloA expression enables the study of dose-dependent effects and temporal requirements.

  • Complementation assays: For knockout strains, reintroducing wild-type or mutant versions of eloA can help identify critical functional domains.

When designing these genetic manipulations, researchers should consider the developmental timing of experiments, as D. discoideum undergoes significant physiological changes during its life cycle that may affect eloA function and importance .

How does eloA activity impact D. discoideum development and spore formation?

The relationship between fatty acid metabolism and D. discoideum development appears complex and significant. While specific data on eloA is limited, research on related fatty acid metabolism proteins provides important insights:

In D. discoideum, cells that have accumulated storage fat from added fatty acids show impaired progression through the starvation period preceding spore development . When mixed populations of wild-type and fatty acid metabolism mutants (such as fcsA, dgat1, and dgat2 knockouts) undergo development together, the mutants show a strong competitive advantage in forming spores .

This table summarizes the relationship between fatty acid metabolism and spore formation based on mixing experiments:

Cell Types MixedPre-treatmentSpore Formation Outcome
WT + WTNone~50% each strain
WT + Fat metabolism mutantsNone~50% each strain
WT (palmitic acid treated) + Fat metabolism mutantsWT only>90% mutant spores
WT + Fat metabolism mutants (palmitic acid treated)Mutants only75-80% mutant spores
WT (palmitic acid treated) + Fat metabolism mutants (palmitic acid treated)BothMutants strongly dominant

This suggests that eloA activity, which likely contributes to fatty acid elongation and subsequent lipid droplet formation, might negatively impact a cell's ability to form spores when overactive or when cells are exposed to excess fatty acids .

What is known about the structural characteristics of eloA compared to other fatty acid metabolism proteins?

While specific structural information about eloA is not directly provided in the search results, insights can be gained from related proteins in D. discoideum:

D. discoideum contains several proteins involved in fatty acid metabolism with well-characterized domains. For instance, the steely proteins possess six catalytic domains homologous to metazoan type I fatty acid synthases (FASs) . These domains include:

  • Ketosynthase (KS)

  • Acyltransferase (AT)

  • Dehydratase (DH)

  • Enoylreductase (ER)

  • Ketoreductase (KR)

  • Acyl carrier protein (ACP)

By analogy, eloA likely contains conserved domains characteristic of fatty acid elongation proteins, potentially including condensing enzyme activity and interaction sites for acyl-CoA and malonyl-CoA substrates. Crystal structure studies similar to those performed for the steely C-terminal domain could provide valuable insights into eloA function .

What methodologies are recommended for producing functional recombinant eloA?

Based on successful approaches with other D. discoideum proteins, several methodologies are recommended for producing functional recombinant eloA:

  • Expression system selection: For functional studies of D. discoideum proteins, E. coli expression systems have been successfully used for recombinant protein production, as demonstrated with the steely C-terminal type III PKS domain . Alternative systems include insect cells (Sf9) for proteins requiring eukaryotic post-translational modifications.

  • Protein purification strategy:

    • Affinity tags: His-tag or GST-tag for simplified purification

    • Size exclusion chromatography for achieving high purity

    • Activity-preserving buffer conditions during purification

  • Functional validation:

    • In vitro enzyme assays using labeled substrates (similar to those used for steely proteins)

    • Activity measurements using unlabeled substrates with analytical detection methods (HPLC, LC-MS)

    • Structural validation via circular dichroism or thermal shift assays

  • Storage conditions:

    • Optimize buffer components to maintain stability

    • Determine appropriate storage temperature (-80°C, -20°C, or 4°C)

    • Evaluate the need for glycerol or other stabilizing agents

When developing these methodologies, researchers should consider that fatty acid elongation proteins typically require specific cofactors and may be sensitive to oxidation, necessitating the inclusion of reducing agents in buffers .

How does eloA function relate to D. discoideum's unique life cycle transitions?

The function of eloA in fatty acid metabolism likely plays an important role in D. discoideum's life cycle transitions, particularly during the shift from vegetative growth to development. D. discoideum undergoes a complex developmental program when starved, transitioning from individual amoebae to a multicellular fruiting body .

Research has shown that lipid metabolism significantly impacts this developmental progression. For example:

  • Cells with accumulated lipid droplets show delayed development when starved

  • Many fatty acid-loaded cells fail to proceed through development even after 48 hours

  • Different fatty acids have distinct effects on development - palmitic acid causes slight developmental delays, while oleic acid severely impairs development

As a protein involved in fatty acid elongation, eloA likely influences these developmental transitions by affecting the cellular lipid composition. Its activity may need to be tightly regulated during development to ensure proper energy utilization and signaling for morphogenesis.

What evolutionary insights can be gained from studying eloA in D. discoideum?

Studying eloA in D. discoideum offers valuable evolutionary insights into fatty acid metabolism across eukaryotes. D. discoideum occupies an interesting evolutionary position, having diverged after plants but before the fungi/metazoa split .

The fatty acid metabolism machinery in D. discoideum shows interesting evolutionary adaptations. For example, the steely proteins represent hybrid enzymes that combine domains from both fatty acid synthases and polyketide synthases . This suggests evolutionary innovation in fatty acid metabolism pathways.

By studying eloA in this context, researchers can:

  • Identify conserved mechanisms of fatty acid elongation across evolutionary distance

  • Discover unique adaptations specific to the D. discoideum lineage

  • Gain insights into the evolution of lipid metabolism regulation in relation to developmental complexity

  • Understand how fatty acid elongation functions evolved in concert with multicellularity

These evolutionary insights could have broader implications for understanding fatty acid metabolism across species and potentially inform research in other organisms, including humans .

How can recombinant eloA be used in conjunction with other tools for comprehensive D. discoideum lipid metabolism studies?

Recombinant eloA can be integrated with multiple research tools to enable comprehensive studies of D. discoideum lipid metabolism:

  • Combined with recombinant antibodies: Recombinant antibodies against D. discoideum antigens can be used alongside recombinant eloA for co-localization studies, pull-down assays, and functional validation .

  • Integration with genetic knockout studies: Recombinant eloA can be used for complementation studies in knockout strains, enabling structure-function analyses of specific protein domains .

  • Metabolomic profiling: Recombinant eloA can be used in in vitro assays to generate specific fatty acid products, which can then be identified in cellular extracts to track metabolic pathways .

  • Systems biology approaches: Data from recombinant eloA studies can be integrated with transcriptomic, proteomic, and lipidomic datasets to build comprehensive models of D. discoideum lipid metabolism .

  • Biosensor development: Recombinant eloA could potentially be modified to create biosensors for specific fatty acids or pathway intermediates, enabling real-time monitoring of lipid metabolism in living cells.

This multi-faceted approach would enable researchers to develop a more complete understanding of how fatty acid elongation integrates with other aspects of D. discoideum biology, particularly during developmental transitions and in response to environmental stressors .

What are the common pitfalls when working with recombinant eloA and how can they be addressed?

When working with recombinant eloA from D. discoideum, researchers may encounter several challenges that require specific solutions:

  • Protein solubility issues: Membrane-associated proteins like those involved in fatty acid metabolism often have hydrophobic regions that can cause aggregation.

    • Solution: Optimize expression conditions (temperature, induction time), use solubility tags (MBP, SUMO), or explore detergent screening for purification .

  • Maintaining enzymatic activity: Elongation enzymes may lose activity during purification due to cofactor loss or oxidation.

    • Solution: Include appropriate cofactors (NADPH, NADH) and reducing agents in buffers, and minimize freeze-thaw cycles .

  • Substrate availability: Natural substrates for elongation enzymes can be difficult to obtain commercially.

    • Solution: Consider synthesizing substrates or using commercially available analogs that have been validated in similar systems .

  • Assay development challenges: Detecting elongation activity often requires specialized analytical methods.

    • Solution: Develop robust assays using labeled substrates or coupling reactions to enable spectrophotometric detection .

  • Expression host limitations: E. coli may not provide the proper environment for eukaryotic protein folding.

    • Solution: Consider yeast or insect cell expression systems that might better preserve the native structure of D. discoideum proteins .

Addressing these challenges requires careful optimization and potentially adapting methods that have proven successful for related proteins in the D. discoideum system.

How can researchers optimize the yield and purity of functional recombinant eloA?

Optimizing yield and purity of functional recombinant eloA requires consideration of multiple factors throughout the expression and purification process:

  • Expression vector design:

    • Include a codon-optimized sequence for the expression host

    • Select appropriate promoters (T7, tac) for controlled expression

    • Consider fusion partners that enhance solubility while maintaining function

  • Expression conditions optimization:

    • Test multiple induction temperatures (18°C, 25°C, 30°C)

    • Vary IPTG concentration (0.1-1.0 mM) and induction time (4-24 hours)

    • Evaluate different media formulations (LB, TB, auto-induction)

  • Cell lysis considerations:

    • Include protease inhibitors to prevent degradation

    • Test different lysis methods (sonication, French press, gentle detergents)

    • Optimize buffer composition to maintain protein stability

  • Purification strategy:

    • Implement a multi-step purification approach

    • Consider on-column refolding for proteins recovered from inclusion bodies

    • Validate protein activity after each purification step

  • Quality control measures:

    • Assess protein homogeneity by SDS-PAGE and size exclusion chromatography

    • Confirm identity by mass spectrometry

    • Verify functional activity using established enzyme assays

Based on approaches used for other D. discoideum proteins, a yield of 5-10 mg of purified recombinant eloA per liter of bacterial culture would be a reasonable target .

What emerging technologies could advance our understanding of eloA function?

Several emerging technologies hold promise for advancing our understanding of eloA function in D. discoideum:

  • CRISPR-Cas9 gene editing: While traditional disruption approaches have been successful in D. discoideum , CRISPR technology could enable more precise genetic manipulations, including point mutations and domain-specific alterations in eloA.

  • Cryo-electron microscopy: This technique could reveal the detailed structure of eloA alone or in complex with other fatty acid metabolism proteins, building on the structural work done with steely protein domains .

  • Single-cell omics: Applying single-cell transcriptomics and proteomics could reveal heterogeneity in eloA expression and function during development, particularly when comparing cells that successfully form spores versus those that do not .

  • Metabolic flux analysis: Using stable isotope labeling combined with mass spectrometry could track the flow of fatty acids through elongation pathways, clarifying eloA's specific role in lipid metabolism.

  • Optogenetic control: Developing light-controlled versions of eloA could enable precise temporal control of its activity, allowing researchers to determine exactly when its function is critical during development.

These technologies, combined with the existing toolbox for D. discoideum research, could significantly enhance our understanding of eloA's role in fatty acid metabolism and development.

How might insights from eloA research translate to applications in other biological systems?

Research on D. discoideum eloA has potential applications in several areas:

  • Biomedical research: Insights into fatty acid elongation mechanisms could inform studies of human diseases involving lipid metabolism disorders. The genetic tractability of D. discoideum makes it valuable for studying conserved pathways .

  • Agricultural applications: Understanding fatty acid elongation could contribute to engineering crops with modified oil content or composition.

  • Biofuel development: Knowledge of fatty acid metabolism in D. discoideum could potentially be applied to optimize lipid production in microorganisms used for biofuel generation.

  • Evolutionary biology: As D. discoideum occupies an interesting evolutionary position, eloA research provides insights into the evolution of fatty acid metabolism across eukaryotes .

  • Synthetic biology: The modular nature of fatty acid metabolism enzymes, as seen in the steely proteins , suggests potential for engineering novel biosynthetic pathways that incorporate eloA-like activities.

The fact that fatty acid metabolism in D. discoideum shows both conserved features and unique adaptations makes it a valuable model for translational research across biological systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.