Recombinant Dictyostelium discoideum Elongation of fatty acids protein sre1 (sre1)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Sre1 is a 268-amino acid protein encoded by the sre1 gene (DDB_G0281821) in Dictyostelium discoideum. It belongs to the 3-keto acyl-CoA synthase family (EC 2.3.1.n8), which catalyzes the elongation of fatty acids by adding two-carbon units to acyl-CoA substrates . Key features include:

  • Domains: A conserved MADS-box region and a transmembrane domain critical for membrane association .

  • Expression: Developmentally regulated, with roles in spore maturation and cellulose deposition .

  • Homology: Shares structural similarities with sterol regulatory element-binding proteins (SREBPs) in fungi, which regulate lipid biosynthesis .

Table 1: Biochemical Properties of Recombinant Sre1

PropertyDetails
UniProt IDQ54TC9
Molecular Weight~30 kDa (calculated)
Expression SystemEscherichia coli
TagHis-tag (N-terminal)
Purity>90% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C

Recombinant Production and Purification

Recombinant Sre1 is produced in E. coli systems for biochemical studies. The protein is expressed as a full-length construct (1–268 aa) and purified via affinity chromatography .

  • Expression Vector: Utilizes a pET-based system with an N-terminal His-tag for simplified purification .

  • Yield: Typical yields range from 0.1 to 1.0 mg/mL post-reconstitution .

  • Stability: Repeated freeze-thaw cycles are not recommended; working aliquots are stable at 4°C for one week .

Key Challenges:

  • Solubility issues due to transmembrane domains require optimization of buffer conditions (e.g., Tris/PBS with 6% trehalose) .

  • Functional activity assays necessitate reconstitution with cofactors like NADPH .

3.1. Role in Fatty Acid Biosynthesis

Sre1 catalyzes the elongation of very-long-chain fatty acids (VLCFAs), essential for membrane lipid composition and signaling molecules . In Dictyostelium, this process is critical for producing differentiation-inducing factors (DIFs), polyketide-derived molecules governing multicellular development .

3.2. Developmental Regulation

Disruption of the sre1 homolog (srfA) in Dictyostelium leads to defective spore maturation, including abnormal cellulose deposition and reduced expression of spore-coat markers like spiA . This aligns with findings in fungi, where SREBP homologs (e.g., X. dendrorhous Sre1) regulate both sterol and carotenoid biosynthesis .

Table 2: Functional Insights from Sre1 Studies

OrganismKey FindingReference
D. discoideumRequired for spiA mRNA expression in spores
X. dendrorhousRegulates ergosterol and carotenoid pathways
B. cinereaMediates hypoxia adaptation and virulence

Comparative Analysis with Homologs

Sre1 homologs across fungi and slime molds exhibit conserved roles in lipid metabolism but differ in regulatory mechanisms:

  • Fungi: X. dendrorhous Sre1 directly binds sterol regulatory elements (SREs) to activate mevalonate pathway genes .

  • Dictyostelium: Sre1’s role extends to developmental signaling via DIF biosynthesis .

Functional Divergence: Unlike fungal SREBPs, Dictyostelium Sre1 lacks a DUF2014 domain, suggesting lineage-specific adaptations .

Future Directions

  • Mechanistic Studies: Elucidate Sre1’s interaction with acyl-CoA substrates using cryo-EM or X-ray crystallography.

  • Biotechnological Applications: Engineer sre1 for microbial production of specialty lipids or pharmaceuticals .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
sre1; DDB_G0281821; Elongation of fatty acids protein sre1; 3-keto acyl-CoA synthase sre1; Protein SRE1 homolog; Very-long-chain 3-oxoacyl-CoA synthase sre1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
sre1
Target Protein Sequence
MDIVKNYLIAFDQYTANFRWESGVTPLSSYVFPFSTSVIYVLVIFALQAIMKNKKGMVLK GFSIIHNINLIILSFSMMSGVMYAAYQQYLEQGAFSLVCEQSSQSVQGRIGFWIYIFYLS KYYELVDTVILALKKKPIIFLHIFHHMAMVPVTWQWLHDQWLVGSWWCTLVNSFIHVLMY YYYLQTTLGNPCWFKKYITKAQIVQFLTGTAMVSYWFVIRDSEKCQAPLSPAIVSNTINS FFIILFGKFYYDSYKSNSRRQEKLNKVE
Uniprot No.

Target Background

Function
This protein could be involved in the synthesis of very long chain fatty acids.
Database Links
Protein Families
ELO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does sre1 compare to other fatty acid elongases identified in D. discoideum?

The D. discoideum genome contains multiple elongase family proteins, with sre1 being one member of this group. Research has identified several ELO family orthologs in the D. discoideum genome, including a well-characterized elongase called eloA . Unlike eloA, which has been demonstrated to have strict substrate specificity for monounsaturated fatty acids (particularly converting 16:1(Δ9) to produce the unusual 18:1(Δ11) fatty acid), the specific substrate preferences and activity profile of sre1 have not been as thoroughly characterized in the available literature .

The functional diversity among D. discoideum elongases suggests they may have evolved specialized roles in fatty acid metabolism, with each enzyme potentially having distinct substrate preferences and producing different fatty acid products. This specialization is particularly interesting considering D. discoideum's unique lifecycle and the potential role of specialized lipids in its development and differentiation processes .

What are the optimal conditions for working with recombinant sre1 protein in laboratory settings?

When working with recombinant Dictyostelium discoideum Elongation of fatty acids protein sre1, researchers should consider the following optimal storage and handling conditions:

  • Storage temperature: Store the protein at -20°C for general storage, or at -80°C for extended storage periods to maintain stability and activity .

  • Buffer composition: The protein is typically maintained in a Tris-based buffer with 50% glycerol that has been optimized for this specific protein's stability .

  • Working with aliquots: To prevent protein degradation from repeated freeze-thaw cycles, it's recommended to prepare working aliquots that can be stored at 4°C for up to one week .

  • Reconstitution: When reconstituting lyophilized protein, use the recommended buffer slowly with gentle mixing to prevent protein denaturation.

For experimental work, membrane proteins like sre1 often require specific considerations:

  • Maintain mild detergent concentrations above critical micelle concentration in all buffers

  • Consider using liposome reconstitution for functional studies

  • Perform activity assays in conditions that mimic the endoplasmic reticulum environment, where fatty acid elongation typically occurs

What experimental systems are most effective for studying sre1 function?

Several experimental systems can be employed to study sre1 function, with each offering distinct advantages:

  • Heterologous expression in yeast: Similar to the approach used for characterizing eloA , expressing sre1 in yeast systems lacking endogenous elongases allows for clean functional characterization. This system is particularly valuable for determining substrate specificity by feeding the yeast various fatty acid precursors and analyzing the resulting products.

  • D. discoideum knockout/knockdown models: Creating sre1-deficient D. discoideum strains enables the study of phenotypic consequences, particularly in relation to development, chemotaxis, and other processes that might be affected by altered fatty acid composition.

  • In vitro enzymatic assays: Purified recombinant sre1 can be incorporated into artificial membrane systems with appropriate cofactors (malonyl-CoA, NADPH) and fatty acyl-CoA substrates to directly measure elongation activity.

  • Combined approaches with other D. discoideum proteins: Given the presence of other fatty acid metabolism proteins in D. discoideum (like the steely proteins that combine fatty acid synthase domains with polyketide synthase domains ), studying sre1 in concert with these other proteins may provide insights into metabolic networking.

What is known about the catalytic mechanism of sre1 in fatty acid elongation?

While the specific catalytic mechanism of sre1 has not been fully elucidated in the provided search results, it likely follows the general mechanism of fatty acid elongases. As a member of the 3-keto acyl-CoA synthase family (EC 2.3.1.n8) , sre1 would be expected to catalyze the condensation reaction in fatty acid elongation, which involves the following steps:

  • Condensation: Catalyzing the condensation of an acyl-CoA substrate with malonyl-CoA to form a 3-ketoacyl-CoA intermediate with the release of CO₂

  • Reduction: The 3-ketoacyl-CoA is reduced to 3-hydroxyacyl-CoA by a 3-ketoacyl-CoA reductase (KAR)

  • Dehydration: The 3-hydroxyacyl-CoA is dehydrated to trans-2-enoyl-CoA

  • Second reduction: The trans-2-enoyl-CoA is reduced to the elongated acyl-CoA

In D. discoideum, studies on similar elongases like eloA have shown highly specific activity for particular fatty acid substrates, suggesting that sre1 may also have evolved specialized substrate preferences . The protein likely contains catalytic residues crucial for the condensation reaction, and its transmembrane domains would anchor it in the endoplasmic reticulum membrane where fatty acid elongation occurs.

How can researchers differentiate between the activities of different elongases in D. discoideum?

Differentiating between the activities of multiple elongases in D. discoideum requires a combination of approaches:

  • Substrate specificity profiling: Express individual elongases (including sre1) in heterologous systems and test their activity with a panel of potential fatty acid substrates. This approach revealed that eloA specifically elongates monounsaturated fatty acids like 16:1(Δ9) .

  • Genetic manipulation: Create knockout or knockdown strains for each elongase and analyze changes in the organism's fatty acid profile. This can reveal which elongase is responsible for producing specific fatty acids in vivo.

  • Temporal and spatial expression analysis: Monitor the expression patterns of different elongases during D. discoideum's life cycle to identify stage-specific roles.

  • Biochemical inhibition studies: Use specific inhibitors of elongation and analyze their effects on different fatty acid products.

A comparative analysis of substrate specificity between eloA and other D. discoideum elongases might look like:

ElongaseSaturated FA SubstratesMonounsaturated FA SubstratesPolyunsaturated FA SubstratesNotable Products
eloALow activityHigh (esp. 16:1Δ9)Low activity18:1Δ11
sre1To be determinedTo be determinedTo be determinedTo be determined

How is sre1 expression regulated during the D. discoideum life cycle?

D. discoideum has a unique life cycle that transitions between unicellular and multicellular stages depending on nutrient availability . During starvation, cells aggregate and differentiate into two distinct populations—prestalk and prespore cells—which eventually form a fruiting body . This complex developmental process involves significant changes in gene expression patterns.

Genes involved in lipid metabolism, including fatty acid elongases like sre1, likely show regulated expression patterns during these transitions. The production of specific fatty acids may be crucial for:

  • Membrane restructuring during the transition from single-cell to multicellular stages

  • Signaling processes involved in chemotaxis and aggregation

  • Formation of specialized structures during fruiting body development

To properly characterize sre1 regulation during the D. discoideum life cycle, researchers should conduct developmental time-course experiments, monitoring sre1 expression at the mRNA and protein levels throughout the organism's development cycle. This could be coupled with promoter analysis to identify developmental stage-specific regulatory elements.

What role might sre1 play in D. discoideum's adaptation to environmental stress?

While the specific role of sre1 in stress response is not directly addressed in the provided materials, elongases like sre1 likely contribute to D. discoideum's ability to adapt to environmental stressors through membrane lipid remodeling.

Environmental stresses such as temperature changes, osmotic stress, and nutrient limitation often trigger changes in membrane lipid composition as an adaptive response. The elongation of fatty acids, potentially mediated by sre1, could contribute to these adaptations by:

  • Modifying membrane fluidity: Longer fatty acids generally increase membrane rigidity, potentially helping cells adapt to elevated temperatures

  • Altering membrane permeability: Changes in fatty acid composition affect membrane permeability to water and solutes

  • Supporting specialized lipid synthesis: Elongated fatty acids may serve as precursors for specialized lipids involved in stress signaling or protection

To investigate this aspect of sre1 function, researchers could expose wild-type and sre1-deficient D. discoideum to various stressors and compare their survival rates, membrane composition changes, and ability to complete development.

How can studies of sre1 in D. discoideum contribute to understanding neurological disorders?

D. discoideum has emerged as a valuable model system for studying neurological disorders, including Alzheimer's disease, Parkinson's disease, Huntington's disease, and others . Although D. discoideum lacks neurons, it contains many orthologs of human genes associated with neurological disorders and exhibits conserved cellular processes relevant to disease mechanisms .

While sre1 itself is not specifically mentioned in connection with neurological disorders in the search results, fatty acid metabolism and membrane composition are increasingly recognized as important factors in neurodegeneration. Studies of sre1 could contribute to understanding neurological disorders in several ways:

  • Membrane lipid composition: Altered membrane lipid composition has been implicated in several neurodegenerative diseases. Understanding how elongases like sre1 regulate membrane composition could provide insights into disease mechanisms.

  • Protein-lipid interactions: Many proteins implicated in neurological disorders interact with membrane lipids. Changes in fatty acid elongation could affect these interactions.

  • Mitochondrial function: Fatty acid metabolism is closely linked to mitochondrial function, which is often compromised in neurodegenerative diseases. D. discoideum has been used to study mitochondrial aspects of Parkinson's disease , and sre1 could be relevant to these pathways.

  • Bioactive lipid signaling: Specialized lipids derived from elongated fatty acids may function as signaling molecules that affect cellular processes relevant to neurodegeneration.

What methodological considerations should be addressed when using D. discoideum as a model for studying fatty acid metabolism in relation to human disease?

When using D. discoideum to study fatty acid metabolism genes like sre1 in relation to human disease, researchers should consider several methodological aspects:

  • Evolutionary conservation assessment: Determine the degree of sequence and functional conservation between D. discoideum sre1 and human elongases. Complementation studies, where the human ortholog is expressed in sre1-deficient D. discoideum, can help establish functional equivalence.

  • Contextual differences: D. discoideum lacks neurons and certain tissue-specific contexts present in humans. Research should focus on conserved cellular processes rather than organism-level manifestations of disease.

  • Developmental stage selection: Different stages of the D. discoideum life cycle may provide different insights. The unicellular stage may be better for studying basic cellular processes, while the multicellular stage may reveal insights about cell-cell communication.

  • Phenotypic readouts: Identify appropriate phenotypic "readouts" that correlate with disease processes. For example:

    • Mitochondrial function measurements

    • Autophagy and protein degradation assays

    • Endocytosis and phagocytosis efficiency

    • Chemotaxis and cell movement analysis

  • Combined genetic approaches: Consider creating compound mutants where sre1 disruption is combined with mutations in other genes associated with neurological disorders, similar to approaches used with Parkinson's-related genes in D. discoideum .

What are the most effective approaches for determining sre1 substrate specificity?

Determining the substrate specificity of sre1 requires a systematic approach combining several experimental techniques:

  • Heterologous expression system: Express sre1 in a system with minimal background elongase activity, such as yeast mutants deficient in endogenous elongases. This approach was successfully used to characterize eloA from D. discoideum .

  • Substrate feeding experiments: Supply the expression system with various potential fatty acid substrates, including:

    • Saturated fatty acids of different chain lengths (C8-C20)

    • Monounsaturated fatty acids with different positions of unsaturation

    • Polyunsaturated fatty acids

    • Unusual fatty acids to test the enzyme's promiscuity

  • Comprehensive product analysis: Use gas chromatography-mass spectrometry (GC-MS) to analyze the fatty acid products formed. This should include derivatization techniques to enhance detection and separate isomers.

  • Kinetic analysis: Measure reaction rates with different substrates to determine kinetic parameters (Km, Vmax) that quantitatively define substrate preference.

  • Structure-based approaches: If structural information becomes available (through crystallography or computational modeling), identify potential substrate-binding regions and test predictions through site-directed mutagenesis.

The results should be presented in a comprehensive manner that allows comparison with other elongases, such as:

SubstrateChain LengthUnsaturationRelative Activity (%)Product IdentifiedKm (μM)
Palmitic acidC16SaturatedTBDTBDTBD
Palmitoleic acidC16Δ9TBDTBDTBD
Stearic acidC18SaturatedTBDTBDTBD
Oleic acidC18Δ9TBDTBDTBD
Linoleic acidC18Δ9,12TBDTBDTBD

How can researchers effectively analyze the impact of sre1 knockout on D. discoideum phenotype and fatty acid profile?

A comprehensive analysis of sre1 knockout effects requires a multi-faceted approach:

  • Gene disruption strategy:

    • CRISPR-Cas9 targeting of the sre1 gene

    • Homologous recombination to replace sre1 with a selectable marker

    • Inducible knockdown using RNAi if complete knockout is lethal

  • Verification of knockout:

    • PCR confirmation of gene disruption

    • Western blot to confirm absence of protein

    • RT-qPCR to check for compensatory upregulation of other elongases

  • Lipidomic analysis:

    • Comprehensive fatty acid profiling using GC-MS

    • Lipidomics to examine changes in complex lipids

    • Stable isotope labeling to track fatty acid flux

    • Comparative analysis with wild-type under different growth conditions

  • Phenotypic characterization across life cycle:

    • Growth rate in axenic medium

    • Response to starvation

    • Chemotaxis efficiency toward cAMP

    • Timing and morphology of multicellular development

    • Fruiting body formation

    • Spore viability and germination

    • Phagocytosis and macropinocytosis efficiency

  • Stress response analysis:

    • Temperature sensitivity

    • Osmotic stress response

    • Resistance to membrane-disrupting agents

    • Recovery from various stressors

  • Rescue experiments:

    • Complementation with wild-type sre1

    • Complementation with mutated versions to identify essential residues

    • Complementation with human orthologs to test functional conservation

How does sre1 function integrate with other fatty acid metabolism pathways in D. discoideum?

While specific details about sre1 integration with other pathways are not provided in the search results, we can draw inferences from the broader context of fatty acid metabolism in D. discoideum:

D. discoideum possesses an interesting combination of fatty acid metabolism enzymes, including both traditional fatty acid synthases and hybrid enzymes like the "steely" proteins that combine features of fatty acid synthases with polyketide synthases . These steely proteins have six catalytic domains homologous to metazoan type I fatty acid synthases but feature an iterative type III polyketide synthase in place of the expected FAS C-terminal thioesterase .

The integration of sre1 with these systems likely involves:

  • Substrate channeling: Products of fatty acid synthases may serve as substrates for sre1-mediated elongation. The coordination between these systems would determine which fatty acids undergo further elongation.

  • Regulatory crosstalk: Shared regulatory mechanisms may coordinate the activities of different fatty acid metabolism enzymes in response to developmental signals or environmental conditions.

  • Metabolic networking: The products of sre1 may feed into multiple downstream pathways, including:

    • Membrane phospholipid synthesis

    • Storage lipid formation

    • Synthesis of signaling lipids

    • Production of substrates for other modifications (desaturation, hydroxylation)

  • Developmental programming: Different combinations of fatty acid metabolism enzymes may be activated during different stages of D. discoideum development, with sre1 potentially playing stage-specific roles.

What techniques are most effective for studying the membrane localization and protein-protein interactions of sre1?

Investigating the membrane localization and protein-protein interactions of sre1 requires specialized techniques suitable for membrane proteins:

  • Subcellular localization:

    • Fluorescent protein tagging (e.g., GFP-sre1 fusion) for live cell imaging

    • Immunofluorescence with anti-sre1 antibodies

    • Subcellular fractionation followed by Western blotting

    • Correlative light and electron microscopy for high-resolution localization

  • Membrane topology analysis:

    • Protease protection assays to identify cytosolic domains

    • Glycosylation site insertion to probe luminal domains

    • Cysteine accessibility methods to map transmembrane regions

    • Computational predictions validated by experimental approaches

  • Protein-protein interaction studies:

    • Split-GFP complementation for in vivo interaction studies

    • Co-immunoprecipitation with appropriate detergent conditions

    • Proximity labeling techniques (BioID, APEX) to identify neighboring proteins

    • Crosslinking mass spectrometry for capturing transient interactions

    • Yeast two-hybrid with modified systems for membrane proteins

  • Functional complex analysis:

    • Blue native PAGE to preserve native complexes

    • Size exclusion chromatography combined with multi-angle light scattering

    • Single-particle cryo-electron microscopy for structural studies of complexes

    • Genetic interaction screens to identify functional relationships

Given that fatty acid elongation typically occurs in the endoplasmic reticulum, researchers should pay particular attention to sre1's association with this organelle and its potential interactions with other components of the fatty acid elongation machinery.

What are the most promising experimental approaches for understanding the evolutionary significance of sre1 in D. discoideum?

Understanding the evolutionary significance of sre1 requires comparative approaches across multiple species:

  • Phylogenetic analysis:

    • Comprehensive phylogenetic analysis of sre1 homologs across diverse eukaryotes

    • Identification of conserved domains and lineage-specific adaptations

    • Analysis of selection pressure on different regions of the protein

    • Ancestral sequence reconstruction to infer evolutionary history

  • Functional complementation across species:

    • Express sre1 homologs from diverse organisms in D. discoideum sre1 knockout

    • Test whether human elongases can rescue D. discoideum sre1 mutant phenotypes

    • Identify functionally conserved regions through chimeric protein approaches

  • Comparative biochemistry:

    • Compare substrate specificity profiles of sre1 homologs from different organisms

    • Identify evolutionary shifts in catalytic efficiency and substrate preference

    • Correlate biochemical properties with organism-specific lipid compositions

  • Ecological and life-history correlations:

    • Compare the role of sre1-like proteins in organisms with different life cycles

    • Investigate whether sre1 function relates to specific environmental adaptations

    • Study whether the multicellular stages of D. discoideum development present unique selective pressures on fatty acid metabolism

How might systems biology approaches enhance our understanding of sre1 function in cellular homeostasis?

Systems biology offers powerful approaches to understand sre1 within the broader context of cellular metabolism:

  • Integrative -omics approaches:

    • Combine transcriptomics, proteomics, and lipidomics data from wild-type and sre1 mutants

    • Perform time-course analyses throughout development and under various stresses

    • Use network analysis to identify co-regulated genes and metabolic connections

  • Flux analysis:

    • Employ stable isotope labeling to trace carbon flow through fatty acid pathways

    • Develop computational models of fatty acid elongation and incorporation into complex lipids

    • Compare metabolic flux distributions between wild-type and sre1 mutants

  • Genome-scale modeling:

    • Incorporate sre1 into genome-scale metabolic models of D. discoideum

    • Perform flux balance analysis to predict system-wide effects of sre1 perturbation

    • Identify synthetic lethal interactions through in silico gene deletion studies

  • High-throughput phenotyping:

    • Use automated imaging and analysis to characterize sre1 mutants across numerous conditions

    • Apply machine learning to identify subtle phenotypic patterns

    • Develop multi-parameter phenotypic signatures that connect sre1 function to specific cellular processes

  • Single-cell approaches:

    • Apply single-cell transcriptomics to identify cell-type specific roles during development

    • Use single-cell metabolomics to capture cell-to-cell variability in fatty acid profiles

    • Investigate whether sre1 contributes to phenotypic heterogeneity within populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.