Recombinant Dictyostelium discoideum Endoplasmic reticulum transmembrane protein YET-like (DDB_G0287543)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0287543; Endoplasmic reticulum transmembrane protein YET-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0287543
Target Protein Sequence
MEFLMTLVFLVLLVEIVFCTFFMLPVSMHLRKNVYNKLDKLFGGQNAKIFLKVLALLVII VFCDSIVNSYNINKKLHTPELTGAKFDRQNEYTRMFRYQRNSYICGFCLYLFFLIYRSQG IISQLSNVEASKTAIEKQTKNNLNTVETLLSENEKLKTEIKDLKKMEKEHKAMKSQAENT TKEYLKLQEEYNQLLGKKPKTQKKDD
Uniprot No.

Target Background

Function
Plays a potential role in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi apparatus.
Database Links
Protein Families
BCAP29/BCAP31 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is DDB_G0287543 and why is it significant for cellular biology research?

DDB_G0287543 encodes an endoplasmic reticulum transmembrane protein in Dictyostelium discoideum with a length of 206 amino acids. This YET-like protein is particularly significant because it belongs to a family of ER proteins that are evolutionarily conserved across eukaryotes . The protein's transmembrane nature suggests its involvement in ER structure maintenance, protein trafficking, or stress response pathways.

The significance of studying this protein extends beyond Dictyostelium biology, as ER transmembrane proteins are critical components in cellular processes that are often conserved from simple eukaryotes to humans. Understanding DDB_G0287543 can provide insights into fundamental cellular mechanisms, particularly those involving the secretory pathway and ER homeostasis.

How does Dictyostelium discoideum serve as a model organism for studying ER transmembrane proteins?

Dictyostelium discoideum offers several unique advantages for studying ER transmembrane proteins like DDB_G0287543:

  • Evolutionary position: D. discoideum occupies a unique evolutionary position that makes it an excellent model for studying protein conservation across eukaryotes .

  • Experimental tractability: It possesses a haploid genome that facilitates genetic manipulation and analysis of loss-of-function mutations .

  • Life cycle versatility: Its ability to transition between unicellular and multicellular phases allows researchers to study ER protein function in different cellular contexts .

  • Simple phenotypic screening: Aberrant phenotypes can be readily identified through visual inspection during development .

  • Genetic tools: The availability of robust genetic tools, including gene disruption techniques, allows for detailed functional studies .

These characteristics collectively make D. discoideum particularly valuable for investigating the fundamental roles of ER transmembrane proteins in eukaryotic cell biology.

What experimental challenges are associated with studying DDB_G0287543?

Studying DDB_G0287543 presents several experimental challenges that researchers should consider:

  • Protein solubility: As an ER transmembrane protein, DDB_G0287543 contains hydrophobic domains that can complicate expression and purification procedures .

  • Functional redundancy: Potential redundancy with other ER proteins may mask phenotypes in knockout studies.

  • Post-translational modifications: The protein may undergo various modifications that affect its function and localization.

  • Dynamic interactions: Capturing transient protein-protein interactions within the ER membrane environment requires specialized techniques.

  • Subcellular localization: Distinguishing between ER subdomains where the protein functions may require high-resolution imaging methods.

Addressing these challenges requires careful experimental design and often a combination of biochemical, genetic, and imaging approaches.

How should researchers design experiments to study DDB_G0287543 localization and trafficking?

To effectively study the localization and trafficking of DDB_G0287543, researchers should implement a multi-faceted experimental approach:

  • Fluorescent protein tagging: Generate constructs with fluorescent proteins (GFP, mNeongreen) fused to DDB_G0287543, being mindful of tag position to avoid disrupting transmembrane domains or targeting signals .

  • Co-localization studies: Use markers for ER (Sec61), Golgi (Mnn9), and other organelles to determine precise subcellular localization through confocal microscopy .

  • Live cell imaging: Implement time-lapse microscopy to track protein dynamics during cellular processes and developmental stages .

  • Immunogold electron microscopy: For high-resolution localization within ER subdomains.

  • Bimolecular fluorescence complementation (BiFC): To detect potential protein-protein interactions in situ .

  • Photoactivatable tags: Use photoconvertible fluorescent proteins to track protein movement within the secretory pathway.

When designing these experiments, researchers should consider both steady-state localization and dynamic trafficking under various conditions, including during development and stress response.

What approaches are most effective for disrupting DDB_G0287543 function in Dictyostelium?

Several genetic approaches can be employed to disrupt DDB_G0287543 function in Dictyostelium:

  • Homologous recombination: Using optimized protocols based on in vitro transposition for targeted gene disruption .

  • CRISPR-Cas9 system: For precise genome editing with minimal off-target effects.

  • Inducible expression systems: To control the timing of gene disruption, particularly useful for studying essential genes.

  • Dominant-negative constructs: Expression of mutated versions of the protein that interfere with endogenous function.

  • RNA interference: To achieve partial knockdown when complete deletion is lethal.

Experimental protocol example for gene disruption:

  • Design primers surrounding the target region of DDB_G0287543

  • Create a knockout construct containing a blasticidin resistance cassette

  • Transform Dictyostelium cells using electroporation

  • Select transformants on blasticidin-containing media

  • Verify disruption by PCR and RT-PCR to confirm absence of gene expression

PCR verification should include oligonucleotides surrounding the disruption to screen for homologous recombination events, as demonstrated in previous Dictyostelium studies .

How can researchers assess the impact of DDB_G0287543 on ER structure and function?

To evaluate the impact of DDB_G0287543 on ER structure and function, researchers should implement a comprehensive analytical approach:

  • Morphological analysis:

    • Fluorescent markers for ER visualization (e.g., ER-tracker dyes)

    • Transmission electron microscopy to observe ultrastructural changes

    • Quantification of ER membrane expansion/retraction

  • Functional assays:

    • Measurement of protein secretion rates using reporter proteins

    • Analysis of protein glycosylation patterns in wild-type vs. mutant cells

    • Calcium flux measurements using FRET-based calcium sensors

  • Stress response evaluation:

    • Sensitivity to ER stressors (tunicamycin, DTT)

    • Unfolded protein response activation assessment

    • Cell survival under stress conditions

  • Protein trafficking assessment:

    • Pulse-chase experiments to track protein movement

    • Vesicle budding assays from isolated ER membranes

    • Co-immunoprecipitation to identify interaction partners

A comparative analysis between wild-type and DDB_G0287543-disrupted cells across these parameters will provide comprehensive insights into the protein's role in ER biology.

How does DDB_G0287543 potentially participate in ER-Golgi trafficking during Dictyostelium development?

DDB_G0287543, as an ER transmembrane protein, may play a critical role in ER-Golgi trafficking during Dictyostelium development through several potential mechanisms:

  • Protein cargo selection: It may function in selecting specific proteins for transport between ER and Golgi during developmental transitions.

  • Vesicle formation: The protein could participate in COPII-coated vesicle formation at ER exit sites, similar to how Erd1 functions in other systems .

  • Retrieval mechanisms: DDB_G0287543 might be involved in retrograde transport from Golgi to ER, particularly for proteins containing ER retention signals like the KDEL/HDEL motifs .

  • Developmental regulation: Its expression or activity may be regulated during the transition from growth to development in Dictyostelium .

Research by Hardwick and Pelham demonstrated that mutations in ER retrieval systems result in secretion of ER-resident proteins containing HDEL sequences . A similar phenotype may be observed if DDB_G0287543 functions in retrieval pathways. During Dictyostelium development, proper protein trafficking between ER and Golgi becomes especially critical as the proteome dramatically changes to support multicellular aggregation and differentiation .

What techniques are recommended for analyzing protein-protein interactions involving DDB_G0287543?

To comprehensively analyze protein-protein interactions involving DDB_G0287543, researchers should employ multiple complementary techniques:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged DDB_G0287543 in Dictyostelium

    • Perform crosslinking to capture transient interactions

    • Purify using anti-tag antibodies under native conditions

    • Identify binding partners via mass spectrometry

  • Yeast two-hybrid (Y2H) screening:

    • Use split-ubiquitin Y2H systems optimized for membrane proteins

    • Screen against Dictyostelium cDNA libraries

    • Validate interactions through secondary assays

  • Bimolecular fluorescence complementation (BiFC):

    • Fuse potential interaction partners with complementary fragments of fluorescent proteins

    • Visualize interactions in living cells

    • Quantify signal intensity to assess interaction strength

  • Co-immunoprecipitation with specific controls:

    • Include detergent controls to distinguish membrane-dependent interactions

    • Perform reciprocal co-IPs to confirm specificity

    • Use crosslinking to capture weak/transient interactions

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins to identify proximal proteins in native cellular context

    • Particularly useful for identifying transient or weak interactions

A comprehensive interactome analysis would provide insights into the functional networks DDB_G0287543 participates in within the ER membrane environment.

How might calcium signaling pathways intersect with DDB_G0287543 function in Dictyostelium?

Calcium signaling pathways likely intersect with DDB_G0287543 function in Dictyostelium through several potential mechanisms:

  • ER calcium storage: As an ER transmembrane protein, DDB_G0287543 may influence ER calcium homeostasis, which is critical during Dictyostelium development .

  • Calcium oscillations: During aggregation and mound stages of Dictyostelium development, cells exhibit calcium oscillations with periods of 2.95-5.29 minutes . DDB_G0287543 may participate in regulating these oscillations.

  • Calcium-dependent interactions: The protein might undergo conformational changes or interaction modifications in response to calcium fluctuations.

  • Developmental regulation: Calcium signaling dynamics change throughout Dictyostelium development, with distinct patterns observed in:

    • Early aggregation: 5.29 ± 0.59 min oscillation periods

    • Early mound: 2.95 ± 0.61 min oscillation periods

    • Late mound: 4.60 ± 0.89 min oscillation periods

Research has shown that calcium signaling is involved in mechanosensing in both unicellular and multicellular phases of Dictyostelium development . To investigate the relationship between DDB_G0287543 and calcium signaling, researchers could use genetically encoded calcium indicators (GECIs) like YC-Nano15 or GCaMP6s in wild-type and DDB_G0287543-mutant backgrounds to compare calcium dynamics during development.

What are the optimal conditions for expressing and purifying recombinant DDB_G0287543?

Optimal expression and purification of recombinant DDB_G0287543 requires careful consideration of its transmembrane nature:

Expression systems:

Expression SystemAdvantagesLimitationsRecommended Use
E. coliCost-effective, high yieldMay form inclusion bodiesGood for initial structural studies with refolding
Insect cellsBetter membrane protein foldingMore complex, lower yieldPreferred for functional studies
DictyosteliumNative post-translational modificationsLower yieldBest for interaction studies

Purification protocol:

  • Membrane isolation:

    • Harvest cells and disrupt by sonication or French press

    • Isolate membranes by differential centrifugation

    • Wash membranes to remove peripheral proteins

  • Solubilization:

    • Test multiple detergents (DDM, LMNG, GDN) at various concentrations

    • Include stabilizing agents (glycerol, specific lipids)

    • Optimize buffer conditions (pH 7.4-8.0, 150-300 mM NaCl)

  • Affinity purification:

    • Utilize His-tag for IMAC purification

    • Include imidazole gradient elution to minimize non-specific binding

    • Consider on-column detergent exchange

  • Quality control:

    • Size-exclusion chromatography to assess monodispersity

    • Circular dichroism to verify secondary structure

    • Thermal stability assays to optimize buffer conditions

For structural studies, consider incorporating nanodiscs or amphipols during the final purification steps to maintain a more native-like lipid environment.

How can researchers troubleshoot common problems in DDB_G0287543 localization studies?

When troubleshooting localization studies of DDB_G0287543, researchers should consider these common issues and solutions:

  • Mislocalization due to overexpression:

    • Use inducible promoters to control expression levels

    • Compare multiple tagged constructs with different expression levels

    • Validate with antibody staining of endogenous protein when possible

  • Tag interference with localization signals:

    • Try both N- and C-terminal tags, noting that N-terminal tagging of glycosyltransferases has been reported to cause ER retention

    • Use small epitope tags (FLAG, HA) as alternatives to fluorescent proteins

    • Consider split-tag approaches that minimize structural disruption

  • Fixation artifacts:

    • Compare multiple fixation methods (paraformaldehyde, glutaraldehyde)

    • Validate with live cell imaging when possible

    • Use rapid fixation techniques to preserve native structures

  • Distinguishing ER subdomains:

    • Use markers for different ER subdomains (rough ER, smooth ER, ERES)

    • Implement super-resolution microscopy techniques

    • Consider correlative light and electron microscopy (CLEM)

  • Dynamic protein behavior:

    • Implement FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

    • Use photoconvertible tags to track protein movement

    • Perform time-course experiments during development

When interpreting localization data, it's essential to remember that membrane proteins may exist in multiple subcellular pools with different functions, especially during Dictyostelium's developmental transitions.

What controls are essential when analyzing phenotypes of DDB_G0287543 mutants?

When analyzing phenotypes of DDB_G0287543 mutants, the following controls are essential to ensure reliable and interpretable results:

  • Genetic controls:

    • Multiple independent mutant clones to rule out off-target effects

    • Rescue experiments with wild-type DDB_G0287543 to confirm phenotype specificity

    • Complementation with homologs from other species to assess functional conservation

  • Experimental controls:

    • Include parental strain in all assays under identical conditions

    • Test multiple strain backgrounds if possible, as phenotypes can vary by genetic background

    • Include positive controls for phenotypic assays (known ER stress-sensitive mutants)

  • Phenotypic validation:

    • Confirm genotype-phenotype correlation through multiple approaches

    • Use both qualitative and quantitative measures of developmental phenotypes

    • Assess phenotypes across multiple developmental stages

  • Stress response controls:

    • Include non-ER stressors to test specificity of stress response phenotypes

    • Titrate stress conditions to identify subtle phenotypic differences

    • Test recovery after stress removal

  • Molecular validation:

    • Verify disruption by PCR and RT-PCR to confirm absence of gene expression

    • Assess potential compensation by related genes through expression analysis

    • Perform Western blots to confirm protein absence

For developmental phenotypes, both microscopic observation and quantitative measures using strains containing fluorescent reporters for different developmental stages provide robust phenotypic assessment .

How might studying DDB_G0287543 inform our understanding of related proteins in human disease?

Studying DDB_G0287543 in Dictyostelium has significant potential to inform our understanding of related human ER transmembrane proteins and their roles in disease:

  • Conserved ER functions: Insights from DDB_G0287543 may reveal fundamental mechanisms of ER protein trafficking, folding, and quality control that are conserved in humans and implicated in diseases like:

    • Neurodegenerative disorders (Alzheimer's, Parkinson's)

    • Cystic fibrosis and other protein folding diseases

    • ER stress-related metabolic disorders

  • Developmental insights: Understanding how DDB_G0287543 functions during Dictyostelium's transition from unicellular to multicellular states may illuminate similar processes in human development and disease.

  • Stress response pathways: Dictyostelium has been shown to be remarkably resistant to DNA damaging agents , and studying how ER proteins like DDB_G0287543 function under stress may reveal novel protective mechanisms relevant to human disease resistance.

  • Drug discovery applications: The ability to perform functional genomic screens in Dictyostelium allows for comparison of molecular modes of action of different compounds , potentially identifying new therapeutic targets for ER-related diseases.

Dictyostelium research has already contributed to understanding human disease genes, as it contains many orthologs of genes defective in human diseases . Similar contributions could arise from studying DDB_G0287543 and its potential human orthologs.

What are the most promising approaches for elucidating the molecular function of DDB_G0287543?

The most promising approaches for elucidating the molecular function of DDB_G0287543 combine cutting-edge technologies with the unique advantages of the Dictyostelium model system:

  • Integrative structural biology:

    • Cryo-electron microscopy to determine protein structure in membrane context

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • In silico molecular dynamics simulations to predict functional domains

  • Multi-omics approaches:

    • Transcriptomics to identify genes affected by DDB_G0287543 disruption

    • Proteomics to characterize changes in protein abundance and modification

    • Lipidomics to assess effects on ER membrane composition

  • Advanced genome editing:

    • Structure-guided mutagenesis of specific domains

    • Creation of chimeric proteins to test domain-specific functions

    • Introduction of optogenetic control elements for temporal regulation

  • Systems biology integration:

    • Network analysis of protein-protein interactions

    • Incorporation of data into developmental models

    • Cross-species comparative analyses

  • Synthetic biology approaches:

    • Reconstruction of minimal ER trafficking systems

    • Engineering of orthogonal membrane systems to test specific hypotheses

    • Design of biosensors to monitor protein activity in vivo

By combining these approaches with Dictyostelium's experimental tractability, researchers can develop a comprehensive understanding of DDB_G0287543's molecular function in its native cellular context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.