Recombinant Dictyostelium discoideum FK506-binding protein 3 (fkbp3)

Shipped with Ice Packs
In Stock

Description

General Information on FKBPs

FKBPs are a unique group of chaperone proteins present in diverse organisms . They facilitate protein folding, regulate cytokines, transport steroid receptor complexes, bind nucleic acids, assemble histones, and modulate apoptosis . These functions are often mediated by specific domains with distinct tertiary conformations .

FKBP3 Function and Interactions

FKBP3 is a member of the immunophilin protein family . It functions as a cis-trans prolyl isomerase, catalyzing the interconversion between prolyl cis/ trans conformations . FKBP3 can bind to immunosuppressants like FK506 and rapamycin, as well as histone deacetylases . It also interacts with the transcription factor YY1, casein kinase II, and nucleolin . FKBP3 exhibits a higher affinity for rapamycin than FK506, making it a potential target for immunosuppression by rapamycin .

Dictyostelium discoideum as a Model Organism

Dictyostelium discoideum, a cellular slime mold, serves as a valuable model organism for studying cell and developmental biology due to its simple life cycle and ease of use . Research on Dictyostelium has provided insights into various cellular processes, including those modulated by FKBPs .

Role of Calcineurin in Dictyostelium discoideum

Studies involving RNAi-mediated manipulation of calcineurin expression in Dictyostelium discoideum have revealed its role in development . Silencing the cnbA gene, which encodes the regulatory B subunit of calcineurin, leads to developmental aberrations, such as slower development and the formation of short stalks . Experiments using the inhibitors Cyclosporin A (CsA) and FK506 suggest that calcineurin regulates calcium stress-induced transcription activation and the expression of calcium-binding proteins .

Differentiation-Inducing Factors (DIFs) in Dictyostelium discoideum

Dictyostelium discoideum produces differentiation-inducing factors (DIFs) that modulate the formation of distinct cell types . These factors, including DIF-1, DIF-2, and DIF-3, induce stalk-cell differentiation and modulate chemotactic cell movement . Research has focused on understanding the mechanisms underlying the functions of DIFs, though their receptors remain undetermined .

Structure-Based Classification of FKBPs

The prediction of tertiary structures for 45 FKBPs in 23 species has allowed for structure-based classification and the inference of functional roles of newly discovered FKBPs . These analyses have revealed significant similarity in tertiary conformations among orthologous FKBPs, suggesting gene duplications and domain insertion events during evolution . Docking simulations indicate that the incorporation of additional domains may affect the affinity of FKBP domains for FK506 and create novel active sites for drug binding .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
fkbp3; impA; DDB_G0285455; FK506-binding protein 3; Peptidyl-prolyl cis-trans isomerase; PPIase; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-194
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fkbp3
Target Protein Sequence
QEIGVSILKTDTPKGECKGKTASIGDYISLKYVGKFEDGTVFDSSEIHGGFSFNFTIGER KVIPGLEIGTINICEGEKRSIKIPYQLAYGENGIENAIPPRTDIYFDLEVVSIEGAPAQP FYYQLIPSVGTIIAFSMLAGFIVLVKFIIKRYPDESNSKKPAPGKPKKTKAAKQN
Uniprot No.

Target Background

Function
PPIases accelerate protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds within oligopeptides.
Database Links
Protein Families
FKBP-type PPIase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the evolutionary significance of FKBP3 in Dictyostelium discoideum?

FKBP3 in Dictyostelium discoideum represents an evolutionarily conserved protein family found across eukaryotic organisms. The high degree of sequence homology in FKBP proteins, particularly within their functional domains, highlights their fundamental importance across species. Similar to mammalian systems, Dictyostelium FKBP3 likely plays crucial roles in protein folding and cellular signaling pathways. Comparative genomic studies reveal that Dictyostelium discoideum retains both conformational and functional properties of proteins found in other organisms, making it a valuable model for evolutionary studies . The conservation of FKBP3 structure across diverse organisms suggests essential biological functions have been maintained throughout evolutionary history.

How does the structure of Dictyostelium discoideum FKBP3 compare to human FKBP3?

Dictyostelium discoideum FKBP3, like its human counterpart, belongs to the immunophilin protein family, which functions as peptidyl-prolyl cis-trans isomerases (PPIases). Based on homology modeling and sequence analysis, Dictyostelium FKBP3 shares significant structural similarity with human FKBP3, particularly in the catalytic domain responsible for PPIase activity. Human FKBP3 has a molecular weight of approximately 25 kDa (hence also called FKBP25) , and Dictyostelium FKBP3 is expected to have a comparable size. Both proteins contain characteristic FKBP domains that facilitate binding to immunosuppressants such as FK506 and rapamycin, although binding affinities may vary. The conservation of functional domains suggests similar catalytic mechanisms for protein folding acceleration.

What expression systems are optimal for producing recombinant Dictyostelium discoideum FKBP3?

For successful expression of recombinant Dictyostelium discoideum FKBP3, E. coli-based systems have proven effective for related FKBP proteins . The methodology typically involves:

  • Gene optimization: Codon optimization for E. coli expression

  • Vector selection: pET series vectors with appropriate tags (His-tag is commonly used)

  • Strain selection: BL21(DE3) or Rosetta strains to address potential rare codon issues

  • Culture conditions: Induction at lower temperatures (16-20°C) to enhance proper folding

The resulting protein can be purified using methods similar to those employed for human FKBP3, with typical yields of >90% purity as determined by SDS-PAGE analysis . Alternative expression systems including yeast (Pichia pastoris) or insect cells may be considered if post-translational modifications are critical for functional studies.

Expression SystemAdvantagesChallengesTypical Yield
E. coliHigh yield, cost-effective, rapidLimited post-translational modifications10-20 mg/L culture
YeastProper eukaryotic modificationsLonger production time5-15 mg/L culture
Insect cellsComplex modifications, proper foldingTechnical complexity, cost2-10 mg/L culture
DictyosteliumNative modificationsLower yield, complex methodology1-5 mg/L culture

How can recombinant Dictyostelium discoideum FKBP3 be used to study GSK-3 signaling pathways?

Recombinant Dictyostelium discoideum FKBP3 serves as a valuable tool for investigating GSK-3 signaling pathways due to several factors. GSK-3 in Dictyostelium (GskA) shares over 80% similarity in the kinase domain with human GSK-3β , making it an excellent model for comparative studies. The methodological approach for using FKBP3 in GSK-3 research typically involves:

  • Affinity chromatography using tagged FKBP3 to identify and characterize protein binding partners in GSK-3 signaling complexes

  • Co-immunoprecipitation experiments to validate protein-protein interactions in vivo

  • Functional assays to determine the impact of FKBP3 on GSK-3 activity and substrate specificity

Research has demonstrated that GSK-3 fulfills multiple roles during early development in Dictyostelium, including coordination of chemotaxis and cellular polarization . Studying FKBP3's interaction with GSK-3 provides insights into how scaffolding proteins and other binding partners may direct GSK-3 activity toward specific substrates, a mechanism that is likely conserved between Dictyostelium and mammalian systems.

What techniques are most effective for analyzing FKBP3 peptidyl-prolyl isomerase activity in Dictyostelium?

Analyzing the peptidyl-prolyl isomerase (PPIase) activity of Dictyostelium FKBP3 requires specialized techniques that quantify the catalytic conversion of peptide substrates. The most effective approaches include:

  • Spectrophotometric assays using synthetic tetrapeptide substrates (e.g., suc-AAFP-pNA) with chymotrypsin coupling

  • Protease-free assays utilizing peptides with intrinsic fluorescence changes upon cis-trans isomerization

  • NMR-based approaches for direct observation of cis-trans isomerization

The standard activity assay conditions typically include:

  • Buffer: Tris-HCl pH 8.0

  • Temperature: 25°C

  • Activity measurement: Monitoring the cleavage of 1 μmole of suc-AAFP-pNA per minute

  • Specific activity threshold: >490 nmoles/min/mg for purified protein

These methodologies allow researchers to compare enzymatic parameters between Dictyostelium FKBP3 and its homologs in other species, providing insights into evolutionary conservation of catalytic efficiency and substrate specificity.

How can researchers utilize Dictyostelium discoideum FKBP3 as a model for studying Plasmodium falciparum protein function?

Dictyostelium discoideum has emerged as a promising model system for studying Plasmodium falciparum proteins due to its ability to retain both conformational and functional properties of Plasmodium proteins . For FKBP3 specifically, researchers can employ the following methodological approaches:

  • Comparative genomics to identify conserved functional domains and regulatory motifs between Dictyostelium FKBP3 and Plasmodium homologs

  • Heterologous expression of Plasmodium FKBP3 in Dictyostelium to assess functional complementation

  • Creation of chimeric FKBP3 proteins containing domains from both organisms to map specific functional regions

This approach offers several advantages for anti-malarial drug development:

  • Dictyostelium is easier to culture and genetically manipulate than Plasmodium

  • Conservation of protein structure allows for valid drug target identification

  • The simplified cellular environment facilitates mechanistic studies while maintaining essential protein interactions

Successful implementation of this model system could accelerate the development of novel therapeutic approaches against malaria, which is increasingly urgent given the rise of drug resistance in Plasmodium falciparum .

What purification strategy yields the highest activity for recombinant Dictyostelium FKBP3?

The optimal purification strategy for maintaining high enzymatic activity of recombinant Dictyostelium FKBP3 involves a multi-step approach:

  • Affinity chromatography: For His-tagged FKBP3, Ni-NTA or TALON resins provide high selectivity with elution using imidazole gradients (50-250 mM)

  • Ion-exchange chromatography: To remove contaminating proteins and nucleic acids

  • Size-exclusion chromatography: For final polishing and buffer exchange

Critical buffer components for maintaining activity include:

  • 20-50 mM Tris-HCl (pH 7.5-8.0)

  • 150 mM NaCl for stability

  • 0.25-1 mM DTT to maintain reduced cysteines

  • 10-50% glycerol for long-term storage stability

The purified protein should achieve ≥90% purity as assessed by SDS-PAGE and maintain specific activity above 490 nmoles/min/mg . For optimal stability, storage at -20°C with the addition of carrier proteins (0.1% HSA or BSA) is recommended for long-term preservation of enzymatic activity, with avoidance of multiple freeze-thaw cycles.

How can researchers effectively design experiments to identify FKBP3 binding partners in Dictyostelium?

Identifying FKBP3 protein binding partners in Dictyostelium requires systematic experimental approaches:

  • Affinity chromatography with recombinant tagged FKBP3 as bait:

    • Immobilize purified His-tagged FKBP3 on appropriate resin

    • Prepare Dictyostelium lysates under gentle conditions to preserve protein complexes

    • Perform stringent washing steps with increasing salt concentrations to minimize non-specific binding

    • Elute bound proteins and analyze by mass spectrometry

  • Co-immunoprecipitation approaches:

    • Generate specific antibodies against Dictyostelium FKBP3 or use epitope tags

    • Perform immunoprecipitation from various developmental stages to identify stage-specific interactions

    • Include appropriate controls (pre-immune serum, isotype controls)

  • Proximity-based labeling methods:

    • Create fusion proteins with BioID or APEX2 tags

    • Express in Dictyostelium cells and activate labeling

    • Purify biotinylated proteins and identify by mass spectrometry

Similar approaches have successfully identified binding partners of GSK-3 in Dictyostelium , highlighting the applicability of these methods for studying protein-protein interactions in this model organism.

What are the key considerations when designing inhibitor studies for Dictyostelium FKBP3?

When designing inhibitor studies for Dictyostelium FKBP3, researchers should consider:

  • Inhibitor selection:

    • FK506 and rapamycin as classical FKBP inhibitors

    • Synthetic analogs with modified functional groups to assess structure-activity relationships

    • Non-immunosuppressive analogs to distinguish between immunosuppressive and PPIase inhibition effects

  • Experimental controls:

    • Include human FKBP3 as a reference standard

    • Use related FKBPs (e.g., FKBP12) to assess selectivity

    • Include enzyme-free controls to detect non-enzymatic isomerization

  • Assay conditions optimization:

    • Test multiple pH conditions (typical range: pH 7.0-8.5)

    • Assess temperature dependence (typically 25°C is standard)

    • Consider physiologically relevant salt concentrations

  • Data analysis:

    • Determine IC50 values through dose-response curves

    • Calculate Ki values using appropriate enzyme kinetics models

    • Assess inhibition mechanisms (competitive, non-competitive, uncompetitive)

These considerations ensure robust and reproducible inhibitor characterization, facilitating comparison with FKBP3 from other species and potential therapeutic applications.

How should researchers address discrepancies between in vitro and in vivo FKBP3 activity data?

Addressing discrepancies between in vitro and in vivo FKBP3 activity data requires systematic investigation of multiple factors:

  • Environmental conditions:

    • In vitro assays typically use optimized buffer conditions (Tris-HCl pH 8.0) that may differ from the cellular environment

    • The intracellular milieu contains numerous components that can affect enzyme kinetics

    • Variations in temperature, pH, and ionic strength between experimental settings

  • Protein modifications:

    • Post-translational modifications present in vivo may be absent in recombinant proteins

    • Alternative splicing may generate isoforms with different activities

    • Protein complex formation in vivo can modulate activity

  • Methodological approaches for reconciliation:

    • Develop cell-based assays that measure FKBP3 activity in intact cells

    • Use cellular fractionation to assess activity in different compartments

    • Employ genetic approaches (knockdown/knockout) to correlate phenotypic changes with biochemical parameters

  • Data interpretation framework:

    • Acknowledge the complementary nature of in vitro and in vivo data

    • Develop mathematical models that account for cellular complexity

    • Consider kinetic parameters in the context of physiological substrate concentrations

This comprehensive approach allows researchers to build a more complete understanding of FKBP3 function that bridges biochemical and cellular perspectives.

What are the critical factors that affect reproducibility in Dictyostelium FKBP3 studies?

Ensuring reproducibility in Dictyostelium FKBP3 studies requires attention to several critical factors:

  • Protein expression and purification:

    • Batch-to-batch variation in recombinant protein production

    • Differences in purification protocols affecting protein activity

    • Storage conditions impacting long-term stability

    • Presence of co-purifying contaminants with enzymatic activity

  • Experimental conditions:

    • Precise control of temperature, pH, and buffer composition

    • Standardization of substrate preparation and quality

    • Instrument calibration and measurement consistency

    • Reagent sources and lot-to-lot variability

  • Biological variability in Dictyostelium:

    • Growth conditions affecting cell physiology

    • Developmental stage-specific differences in protein expression

    • Genetic drift in laboratory strains

    • Media composition effects on cellular responses

  • Recommended standardization approaches:

    • Development of standard operating procedures (SOPs)

    • Inclusion of reference standards in each experimental set

    • Detailed reporting of all experimental parameters

    • Use of multiple complementary techniques to validate findings

By systematically addressing these factors, researchers can enhance the reproducibility and reliability of Dictyostelium FKBP3 studies, facilitating meaningful comparisons across different research groups.

How can researchers effectively integrate structural and functional data to develop a comprehensive model of Dictyostelium FKBP3 activity?

Integrating structural and functional data for Dictyostelium FKBP3 requires a multidisciplinary approach:

  • Structural analysis methods:

    • X-ray crystallography or NMR spectroscopy for high-resolution structure determination

    • Homology modeling based on human FKBP3 crystal structures when experimental structures are unavailable

    • Molecular dynamics simulations to explore conformational flexibility

    • Small-angle X-ray scattering (SAXS) for solution-state structural information

  • Functional characterization:

    • Enzymatic assays measuring PPIase activity

    • Mutagenesis studies to identify critical residues

    • Protein-protein interaction mapping

    • Cellular localization and trafficking analysis

  • Integration strategies:

    • Structure-function correlation through site-directed mutagenesis

    • Computational docking of substrates and inhibitors

    • Network analysis of interaction partners

    • Evolutionary analysis across species to identify conserved functional motifs

  • Model validation approaches:

    • Testing predictions through targeted experiments

    • Cross-validation using orthogonal techniques

    • Comparison with related FKBPs from other organisms

    • Iterative refinement based on new experimental data

This integrated approach provides a comprehensive understanding of how FKBP3 structure determines its catalytic properties, binding interactions, and biological functions in Dictyostelium, potentially revealing insights applicable to homologous proteins in other organisms including pathogenic species.

How does Dictyostelium FKBP3 compare to FKBP proteins in Plasmodium falciparum for anti-parasitic drug development?

Comparative analysis of Dictyostelium FKBP3 with Plasmodium falciparum FKBP proteins offers valuable insights for anti-parasitic drug development:

  • Structural similarities and differences:

    • Conserved catalytic domains for PPIase activity

    • Species-specific insertions or deletions that may affect drug binding

    • Potential differences in active site topology affecting inhibitor selectivity

  • Functional conservation:

    • Both organisms utilize FKBP proteins in protein folding and cellular signaling

    • Dictyostelium retains both conformational and functional properties of Plasmodium proteins

    • Developmental roles in both organisms suggest conserved regulatory networks

  • Drug development implications:

    • Dictyostelium FKBP3 can serve as a surrogate for initial screening of anti-Plasmodium compounds

    • Comparative analysis enables identification of parasite-specific features for selective targeting

    • Lower biosafety requirements for Dictyostelium facilitates high-throughput approaches

  • Methodological approach:

    • Side-by-side inhibition assays with recombinant proteins from both organisms

    • Heterologous expression of Plasmodium FKBPs in Dictyostelium to assess functional complementation

    • Structure-based drug design utilizing comparative models

This approach accelerates the development of novel therapeutic strategies against malaria, particularly important given the increasing resistance of Plasmodium falciparum to current antimalarial drugs .

What are the advantages and limitations of using Dictyostelium discoideum as a model system for studying FKBP3 function?

Using Dictyostelium discoideum as a model system for studying FKBP3 function presents distinct advantages and limitations:

AdvantagesLimitations
Ease of genetic manipulationSome mammalian-specific protein interactions may be absent
Simple growth conditionsDifferences in subcellular localization patterns
Haploid genome facilitating gene disruptionLimited tissue-specific functions compared to multicellular organisms
Conservation of basic cellular processesDifferent pharmacology of some inhibitors
Well-characterized developmental programLower complexity of signaling networks
Availability of genomic and proteomic resourcesFewer post-translational modifications
Lower biosafety level requirementsLimited translational applications without validation

Methodological considerations for maximizing advantages while mitigating limitations include:

  • Complementary studies in mammalian systems to validate key findings

  • Focus on evolutionarily conserved pathways and functions

  • Application of comparative genomics to contextualize results

  • Development of chimeric proteins to study domain-specific functions

This balanced approach leverages Dictyostelium's experimental tractability while acknowledging its limitations as a model system for understanding FKBP3 biology across species.

How can researchers effectively transition findings from Dictyostelium FKBP3 studies to mammalian systems?

Translating insights from Dictyostelium FKBP3 research to mammalian systems requires systematic methodological approaches:

  • Homology-based validation:

    • Identify mammalian homologs through phylogenetic analysis

    • Compare protein domain architecture and key functional residues

    • Assess conservation of regulatory mechanisms

  • Functional complementation strategies:

    • Express mammalian FKBP3 in Dictyostelium fkbp3 knockout strains

    • Test rescue of phenotypic defects to confirm functional conservation

    • Create chimeric proteins to map species-specific functional domains

  • Parallel experimental validation:

    • Conduct side-by-side biochemical assays with recombinant proteins from both organisms

    • Compare protein-protein interaction networks

    • Test inhibitors against both Dictyostelium and mammalian FKBP3

  • Translation to disease models:

    • Apply insights to relevant mammalian cell culture models

    • Test hypotheses in mouse models where appropriate

    • Focus on conserved pathways with therapeutic potential

Successful applications of this approach have been demonstrated in studies of GSK-3, where findings from Dictyostelium GskA research have informed understanding of mammalian GSK-3β function , particularly in cellular polarization and development. This bidirectional flow of information maximizes the utility of Dictyostelium as a model organism while ensuring relevance to human health applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.