Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein A (fslA)

Shipped with Ice Packs
In Stock

Description

Proliferation and Cell Density Regulation

Mutants lacking fslA (fslA¯) exhibit near-wild-type proliferation rates and maximum cell densities, contrasting with other GPCR mutants (e.g., fslB¯, fslK¯) .

StrainDoubling Time (h)Max Cell Density (10⁶ cells/mL)
WT14.3 ± 0.221.9 ± 1.7
fslA¯14.8 ± 1.222.1 ± 4.2
fslB¯16.7 ± 1.113.6 ± 1.3**
fslK¯16.1 ± 1.313.7 ± 1.2**
*Values from ; P < 0.01 vs WT.

Chemorepulsion and Signaling Pathways

While fslA¯ cells respond to aprA-induced proliferation inhibition, they remain sensitive to CfaD-mediated growth control . This suggests fslA may not be essential for aprA/CfaD signaling but could participate in alternative pathways.

4. Research Applications and Functional Insights
The recombinant fslA protein is used to study:

  1. GPCR Signaling in Dictyostelium: As part of a redundant GPCR network, fslA may modulate quorum sensing or chemorepulsion .

  2. Cellular Proliferation: Mutant analyses indicate fslA’s role is less central than other receptors (e.g., GrlH) in regulating cell density .

  3. Pathway Redundancy: Multiple GPCRs (GrlB, GrlD, FslB) are required for aprA/CfaD signaling, highlighting a complex regulatory landscape .

5. Production and Experimental Utility
Recombinant fslA is supplied as a lyophilized powder in Tris/PBS buffer with trehalose. Key considerations for use:

  • Reconstitution: 0.1–1.0 mg/mL in deionized water with 5–50% glycerol for long-term storage .

  • Assay Compatibility: Suitable for binding studies, signaling pathway analysis, and structural studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fslA; DDB_G0284761; Frizzled and smoothened-like protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-594
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslA
Target Protein Sequence
QKAINSDAFCQKKTITSICDPYLFNTDSIYIFNSTTTQESIELEIKRLLGFFSMLPSTCQ VPSTYRLICNQYFQTCVPISKTDNSSTIAIPLRPCRESCDYGNGICGTQSITPCTGTFTE PTIYKFPVTSNVFDLSSLGGPSNYDLQCLNIDTMKAGNLNGTYISNNETVIVNQTCVYPL VYRNSTNREDDIKKGYQYLTETSDCLLPCPVPFFTENEWYQFKDLTTVTGVISFVCIFFN IFIYGFLNKKHDRHTIGILCLSFSLWCCMLSDLIVASSPDYSLVCPEPGRFARIHDSRCV ANGIIFQWGAVCTTMFWSAMAIDLYLVIKKLSLPAFTVKYFVAAIFTLALLFTTVPLAWD DYGYGFGGVGCWIMSNSVQNGCFWIPMLICLLIGAVSICLIIYEIVKVFKNVGRSGISII LANARLFGIVSFIFIEYIYLFVYHFWVQENTEKFTQNITDWVICVQTTGSSDGCPLPKAV PYATQFIFLFFLRLLGIEVCIFYGINSRSKNIILESDLVNNKYFKAIRSKISSVGATSTT KNNTSTNNTSDQFNTSMFSVEVSKNGGDDDDL
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the cellular function of fslA in Dictyostelium discoideum?

FslA (Frizzled and smoothened-like protein A) is a putative G protein-coupled receptor in Dictyostelium discoideum that belongs to the family of predicted proteins with sequence similarity to GPCRs. Research indicates that fslA may play a role in cellular functions distinct from some other GPCRs in D. discoideum. Unlike certain GPCR mutants such as grlH^-, fslA^- cells demonstrate normal sensitivity to AprA-induced proliferation inhibition, suggesting that fslA is not directly involved in AprA-mediated chalone activity . Additionally, fslA^- cells exhibit normal chemotactic responses away from rAprA, similar to wild-type cells, indicating that fslA is not essential for AprA-induced chemorepulsion .

Methodologically, the function of fslA can be studied through comparative analysis of knockout mutants against wild-type cells, examining parameters such as proliferation rates, colony morphology, and chemotactic responses to various signals.

How does fslA compare to other G protein-coupled receptors in D. discoideum?

D. discoideum has 61 genes encoding predicted proteins with sequence similarity to GPCRs, with at least 35 of these expressed in vegetative cells . Comparative analysis reveals distinct phenotypic differences between fslA^- and other GPCR mutants:

GPCR MutantDoubling Time (h)Maximum Cell Density (10^6 cells/ml)Sensitivity to rAprAChemorepulsion Response
Wild-type14.3 ± 0.221.9 ± 1.7SensitiveMoves away
fslA^-14.8 ± 1.222.1 ± 4.2SensitiveMoves away
grlH^-13.0 ± 0.1**20.8 ± 1.3InsensitiveMoves toward
grlB^-14.0 ± 0.423.4 ± 1.5InsensitiveNo directional bias

Unlike grlH (which likely functions as an AprA receptor) and other GPCRs that show insensitivity to AprA-induced proliferation inhibition or altered chemorepulsion responses, fslA^- cells maintain wild-type-like responses to AprA . This suggests that fslA may be involved in sensing different extracellular signals or may function in cellular processes distinct from those regulated by AprA.

What experimental approaches are typically used to study fslA expression and localization?

To study fslA expression and localization in D. discoideum, researchers commonly employ:

  • Quantitative PCR (qPCR) to measure fslA mRNA expression levels during different developmental stages and growth conditions.

  • Protein tagging with GFP or other fluorescent markers to visualize subcellular localization through confocal microscopy.

  • Western blotting with anti-fslA antibodies to quantify protein expression levels.

  • Immunofluorescence microscopy to detect the spatial distribution of fslA in cells.

  • Promoter-reporter constructs (such as fslA promoter driving lacZ or GFP expression) to examine transcriptional regulation.

For recombinant fslA, expression can be achieved under control promoters such as the actin15 promoter, similar to the approach used for grlH expression in rescue experiments . Cell fractionation followed by western blotting can determine whether the recombinant protein localizes properly to membrane fractions, as expected for a GPCR.

How can one establish whether fslA functions as a receptor for specific ligands in D. discoideum?

Determining whether fslA functions as a receptor for specific ligands requires a systematic approach:

  • Binding assays: Develop labeled potential ligands and conduct binding studies with purified recombinant fslA or fslA-expressing cells versus knockout cells. Conduct competitive binding assays with unlabeled ligands to determine specificity and affinity.

  • Functional assays: Examine cellular responses (calcium flux, cAMP production, actin polymerization) after exposure to potential ligands in wild-type versus fslA^- cells.

  • Receptor activation studies: Monitor GTP binding to G proteins in membrane preparations from wild-type versus fslA^- cells upon ligand addition.

  • Cross-linking studies: Use photoactivatable cross-linkers attached to potential ligands to identify direct interactions with fslA.

  • Mutational analysis: Create point mutations in the predicted ligand-binding domains of fslA and assess changes in ligand binding and downstream signaling.

While fslA^- cells respond normally to AprA, they may have altered responses to other chemoattractants or chemorepellents that were not tested in the available studies . Testing a wider range of potential ligands, particularly those that might be present in the soil environment where D. discoideum naturally grows, could reveal the specific ligand(s) sensed by fslA.

What are the methodological challenges in producing functional recombinant fslA protein and how can they be overcome?

Producing functional recombinant GPCRs presents several challenges:

  • Membrane protein expression: As a putative GPCR, fslA is a membrane protein that requires a lipid environment for proper folding and function. Expression systems that optimize membrane protein production (such as insect cell systems or specialized E. coli strains) should be employed.

  • Post-translational modifications: If fslA requires glycosylation or other modifications, eukaryotic expression systems (yeast, insect cells, or mammalian cells) would be preferable over bacterial systems.

  • Solubilization and purification: Careful selection of detergents that maintain protein structure during extraction from membranes is critical. A detergent screen (ranging from harsh ionic detergents to milder non-ionic ones) should be conducted.

  • Functional verification: After purification, verify that recombinant fslA retains its ability to bind potential ligands and couple to G proteins using in vitro binding assays or reconstitution in proteoliposomes.

  • Stability considerations: Addition of cholesterol or specific lipids during purification may enhance stability. Consider fusion with stabilizing partners like T4 lysozyme or thermostabilizing mutations.

A successful approach might include using the Bac-to-Bac baculovirus expression system with Sf9 insect cells, followed by solubilization in a mild detergent like DDM or LMNG, and purification via affinity chromatography using an engineered tag that can be later removed.

How does the colony morphology phenotype of fslA^- mutants relate to intercellular signaling pathways?

The observation that fslA^- cells form abnormally small colonies on bacterial lawns suggests a potential role in intercellular signaling during colony expansion . This phenotype could be explored through:

  • Time-lapse microscopy: Analyzing the dynamics of colony expansion in wild-type versus fslA^- cells, particularly focusing on cell movement at colony edges.

  • Cell tracking analysis: Quantifying the directionality and persistence of cell movement within colonies.

  • Mixed population experiments: Co-culturing labeled wild-type and fslA^- cells to determine if the presence of wild-type cells can rescue the colony morphology phenotype through shared extracellular signals.

  • Extracellular matrix analysis: Examining whether fslA affects the production or composition of extracellular matrix components that might influence colony expansion.

  • Transcriptome analysis: Comparing gene expression profiles between wild-type and fslA^- cells during colony formation to identify differentially regulated pathways.

What G protein subunits potentially interact with fslA and how can these interactions be characterized?

To characterize potential G protein interactions with fslA:

  • Co-immunoprecipitation: Express tagged versions of fslA and various G protein subunits, then perform co-immunoprecipitation experiments to identify interacting partners.

  • BRET/FRET assays: Use bioluminescence or fluorescence resonance energy transfer between labeled fslA and G protein subunits to detect direct interactions in living cells.

  • G protein activation assays: Measure GTPγS binding or GTPase activity in membrane preparations from wild-type versus fslA^- cells in response to potential ligands.

  • Genetic epistasis experiments: Create double mutants lacking both fslA and specific G protein subunits to determine if the phenotypes are additive or if one is epistatic to the other.

  • Reconstitution experiments: Reconstitute purified recombinant fslA with purified G proteins in proteoliposomes to measure direct activation.

D. discoideum has 12 Gα subunits, 1 Gβ, and 1 Gγ subunit . Given that AprA signaling requires Gβ and the Gα subunit Gα8 , these would be logical initial candidates to test for interaction with fslA, even though fslA^- cells respond normally to AprA.

How does fslA potentially influence cellular responses to environmental stressors in D. discoideum?

Investigation of fslA's role in stress responses could include:

  • Stress challenge experiments: Expose wild-type and fslA^- cells to various stressors (oxidative stress, osmotic stress, temperature shifts) and measure survival, growth rates, and recovery times.

  • Transcriptome analysis: Compare gene expression profiles of wild-type and fslA^- cells under stress conditions to identify differentially regulated stress response pathways.

  • Metabolomic analysis: Examine changes in metabolite profiles in response to stress in wild-type versus fslA^- cells.

  • Protein phosphorylation studies: Analyze stress-induced signaling pathway activation through phosphoproteomic analysis.

  • Live cell imaging: Monitor stress-induced cellular responses (such as actin cytoskeleton rearrangement or autophagy induction) in real-time.

The research on CadA's role in protecting D. discoideum from oxidative stress during bacterial feeding provides a model for how cell surface receptors can mediate protective responses. Similarly, fslA might be involved in sensing environmental cues that trigger adaptive responses to specific stressors.

What role might fslA play in the transition from vegetative growth to the developmental cycle in D. discoideum?

To investigate fslA's potential role in development:

  • Developmental time course analysis: Compare the timing and morphology of developmental stages between wild-type and fslA^- cells under starvation conditions.

  • Expression analysis: Monitor fslA expression levels throughout the developmental cycle using qPCR and western blotting.

  • Cell-type specific expression: Determine if fslA is expressed in specific cell types (pre-stalk or pre-spore) during development using in situ hybridization or cell-type specific promoter-reporter constructs.

  • Chimeric development: Mix wild-type and fslA^- cells at different ratios and assess their ability to form chimeric fruiting bodies and the distribution of each cell type within these structures.

  • Developmental gene expression: Compare the expression of key developmental genes (such as carA, acaA, pdsA) between wild-type and fslA^- cells during early development.

While the search results primarily discuss fslA in the context of vegetative growth , many GPCRs in D. discoideum have dual roles in growth and development. Given that D. discoideum has 61 predicted GPCRs , functional redundancy might mask developmental phenotypes in single gene knockouts.

How does fslA contribute to bacterial sensing and prey selection in the natural environment?

Investigating fslA's role in bacterial interactions:

  • Bacterial preference assays: Compare the feeding preferences of wild-type and fslA^- cells when presented with multiple bacterial species.

  • Chemotaxis assays: Test chemotactic responses toward different bacterial species or bacterial-derived compounds.

  • Phagocytosis rates: Measure the rates of bacterial uptake and digestion in wild-type versus fslA^- cells.

  • Natural environment isolations: Analyze the bacterial species associated with wild-type versus fslA^- cells isolated from soil samples.

  • Transcriptome responses: Compare gene expression changes in wild-type versus fslA^- cells when exposed to different bacterial species.

The research on CadA as a bacterial agglutinin that forms a protective interface at the plaque edge suggests that D. discoideum has evolved sophisticated mechanisms to optimize interactions with bacteria. FslA might be involved in sensing specific bacterial signals that influence feeding behavior or in regulating responses to bacterial pathogenicity factors.

How conserved is fslA across Dictyostelid species and what does this suggest about its evolutionary significance?

To investigate the evolutionary aspects of fslA:

  • Sequence homology analysis: Compare fslA sequences across different Dictyostelid species to identify conserved domains and species-specific variations.

  • Phylogenetic analysis: Construct phylogenetic trees of fslA and related GPCRs across Dictyostelids and other amoebae to trace evolutionary relationships.

  • Functional complementation: Test whether fslA homologs from other Dictyostelid species can rescue phenotypes in D. discoideum fslA^- mutants.

  • Domain conservation analysis: Identify which domains (e.g., ligand-binding, G protein coupling) show the highest conservation, suggesting functional importance.

  • Selection pressure analysis: Calculate dN/dS ratios to determine whether fslA has been under purifying, neutral, or positive selection during evolution.

The Dictyostelids diverged from each other 600-400 million years ago, providing an excellent system for studying the evolution of signaling pathways. Comparing the roles of fslA homologs across species could reveal whether its function has been conserved or has diverged during evolution.

What structural features distinguish fslA from mammalian Frizzled and Smoothened receptors?

Structural comparison approaches:

  • Homology modeling: Generate structural models of fslA based on crystal structures of mammalian Frizzled and Smoothened receptors.

  • Domain organization analysis: Compare the arrangement of functional domains (ligand-binding pocket, transmembrane helices, intracellular loops) between fslA and mammalian counterparts.

  • Ligand docking simulations: Perform in silico docking of potential ligands to identify differences in binding mechanisms.

  • Mutagenesis studies: Create chimeric receptors or point mutations to exchange functional domains between fslA and mammalian receptors, then test for changes in ligand specificity or signaling.

  • Hydrogen-deuterium exchange mass spectrometry: Compare the dynamics and accessibility of different regions in fslA versus mammalian receptors.

While fslA is classified as a Frizzled and Smoothened-like protein based on sequence similarity, structural differences may reflect adaptation to the unique signaling requirements in D. discoideum compared to mammalian systems. These differences could provide insights into the evolutionary divergence of GPCR signaling across eukaryotes.

What are the optimal conditions for expressing and purifying recombinant fslA for structural studies?

For structural studies of fslA:

  • Expression system optimization:

    • Test multiple expression systems (E. coli, yeast, insect cells, mammalian cells)

    • Optimize codon usage for the chosen expression system

    • Create fusion constructs with stability-enhancing partners (T4 lysozyme, BRIL, thermostabilized GFP)

    • Consider truncated constructs that remove flexible regions while maintaining core structure

  • Purification strategy:

    • Screen detergents systematically (from mild non-ionic like DDM, LMNG to more harsh ionic detergents)

    • Test lipid nanodiscs or amphipols as alternatives to detergents

    • Implement multi-step purification (affinity chromatography followed by size exclusion)

    • Include stabilizing agents (specific lipids, cholesterol, ligands) throughout purification

  • Quality assessment:

    • Use thermal stability assays (CPM, DSF) to monitor protein stability

    • Circular dichroism to confirm secondary structure

    • Size exclusion chromatography with multi-angle light scattering to verify monodispersity

    • Negative stain electron microscopy as a preliminary structural assessment

For crystallization trials, consider the use of lipidic cubic phase techniques that have been successful for other GPCRs, or prepare samples for cryo-electron microscopy by vitrification on grids.

How can CRISPR-Cas9 technology be optimized for genome editing of fslA in D. discoideum?

CRISPR-Cas9 genome editing in D. discoideum for fslA modification:

  • Guide RNA design:

    • Select target sites with minimal off-target potential

    • Design multiple gRNAs targeting different regions of the fslA gene

    • Test gRNA efficiency using in vitro cleavage assays

  • Delivery methods:

    • Optimize electroporation parameters for Cas9-gRNA ribonucleoprotein complex delivery

    • Alternatively, use plasmid-based expression under control of D. discoideum promoters

    • Consider transient versus stable Cas9 expression strategies

  • Homology-directed repair templates:

    • Design templates with 500-1000 bp homology arms

    • Include selection markers flanked by loxP sites for marker removal after selection

    • Incorporate silent mutations in the PAM site or seed region to prevent re-cutting

  • Screening strategies:

    • Develop PCR-based screening methods to identify edited clones

    • Use restriction enzyme digestion or T7 endonuclease assays for preliminary screening

    • Confirm edits by sequencing

  • Off-target analysis:

    • Sequence potential off-target sites predicted by computational tools

    • Perform whole-genome sequencing on edited clones to identify unpredicted off-target effects

D. discoideum has historically been challenging for precise genome editing due to its high A/T content and multicopy genome during vegetative growth. CRISPR-Cas9 offers advantages over traditional homologous recombination methods, but requires optimization for this organism's specific characteristics.

How can transcriptomic and proteomic approaches be integrated to understand the signaling network involving fslA?

Multi-omics integration strategies:

  • Experimental design:

    • Perform RNA-seq and proteomics on wild-type and fslA^- cells under multiple conditions (vegetative growth, development, bacterial exposure)

    • Include time-course experiments to capture dynamic changes

    • Consider subcellular fractionation to enrich for membrane and signaling components

  • Data integration methods:

    • Correlation analysis between transcriptome and proteome data

    • Pathway enrichment analysis across both datasets

    • Protein-protein interaction network construction incorporating differentially expressed genes/proteins

    • Causal network inference to identify regulatory relationships

  • Computational tools:

    • Use tools like WGCNA (Weighted Gene Co-expression Network Analysis) to identify co-regulated modules

    • Apply machine learning approaches to predict functional relationships

    • Implement Bayesian network modeling to infer causal relationships

  • Validation experiments:

    • Targeted knockdowns of key nodes in the predicted network

    • Phosphoproteomics to identify active signaling pathways

    • Direct protein-protein interaction studies for predicted interactions

  • Data visualization:

    • Create integrated network visualizations using tools like Cytoscape

    • Develop custom visualization tools for time-course data integration

This integrated approach can reveal how fslA influences both immediate signaling events and longer-term transcriptional responses, providing a systems-level understanding of its function.

What contradictions exist in the current data regarding fslA function and how might these be resolved?

Addressing contradictions in fslA research:

  • Small colony phenotype vs. normal chemorepulsion:

    • The fslA^- cells form small colonies on bacterial lawns similar to aprA^- cells, yet they show normal chemorepulsion from AprA

    • Resolution approach: Test chemorepulsion to other signals beyond AprA; examine cell-cell interactions within colonies using live imaging; investigate whether fslA affects secretion or sensing of signals other than AprA

  • Normal doubling time vs. altered colony morphology:

    • Despite having normal doubling times in liquid culture, fslA^- cells show altered colony morphology on bacterial lawns

    • Resolution approach: Compare growth parameters in different nutrient conditions; examine whether the phenotype is specific to solid surfaces or bacterial interactions; analyze cell movement patterns within colonies

  • Potential methodological inconsistencies:

    • Different studies may use varying conditions for assays, leading to seemingly contradictory results

    • Resolution approach: Standardize experimental conditions; perform side-by-side comparisons of multiple GPCR mutants under identical conditions; develop quantitative assays with higher sensitivity

  • Genetic background effects:

    • Phenotypes may vary depending on the parent strain used for generating mutants

    • Resolution approach: Create mutants in multiple genetic backgrounds; perform complementation tests; use CRISPR-Cas9 to generate clean knockouts without selection markers

  • Functional redundancy:

    • Other GPCRs may compensate for fslA loss, masking phenotypes

    • Resolution approach: Generate double or triple mutants combining fslA knockout with related GPCRs; perform overexpression studies; use conditional expression systems to study acute effects of fslA loss

Systematic investigation of these contradictions can lead to a more nuanced understanding of fslA function and reveal how it integrates with other signaling pathways in D. discoideum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.