Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein B (fslB)

Shipped with Ice Packs
In Stock

Description

G-Protein Coupled Receptor Activity

fslB is a serpentine receptor implicated in:

  • Folic Acid Sensing: Transcriptional upregulation occurs after folic acid stimulation, though gene disruption did not impair sensing .

  • GABA Signaling: Indirectly linked to GABA metabolism via GrlB interaction during early development .

  • Proliferation Regulation: Required for recombinant CfaD (rCfaD)-mediated proliferation inhibition in D. discoideum .

Adhesion and Aggregation

  • Gα8 Interaction: Facilitates adhesion molecule expression via heterotrimeric G-protein signaling .

  • Delayed Aggregation: Observed in grlB¯ mutants, suggesting crosstalk with fslB-associated pathways .

Table 1: Functional Studies of fslB

StudyKey FindingsCitation
Transcriptional ResponsefslB mRNA levels increase post-folic acid stimulation, but gene disruption has no phenotypic effect.
Chemorepulsion & ProliferationfslB¯ cells show insensitivity to rCfaD, implicating it in chemorepulsive signaling.
GABA MetabolismGABA signaling in early development involves GrlB, potentially interacting with fslB-regulated pathways.
Adhesion MechanismGα8 promotes adhesion via heterotrimer formation, with fslB possibly modulating downstream effectors.

Future Research Directions

  • Mechanistic Insights: Clarify fslB’s role in GABA and AprA signaling cascades.

  • Structural Studies: Resolve full-length 3D structures to identify ligand-binding domains.

  • Therapeutic Potential: Explore homologs in higher eukaryotes for drug-targeting opportunities.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
fslB; DDB_G0270730; Frizzled and smoothened-like protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-642
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslB
Target Protein Sequence
NNNIKTFGLNLPDGYGAGLVDPTATCSNYIGDSIDQPLCNEKLPNYKNIYTSKNITIQYI NQKIVEKTFISLTFLQSKCFDLNFAEFGICDIYFPPCFQTPTTITPIKSVSLPQRLCKSA CERMVSNCSSLGASLNCSDPLKFPRIATLYNLTDYGFTANGGFFPVPCSDPLATFENKST TSELIEICPSPLLLFNSSDPKYSADRGYTYLTPTNCVLPCVAPIYTEKKWHQMYNMSKIL STISFVCSIYNVLTFGILNHRRSKYNYCITFFSASVIIITMMDIVTYGIGYEKLLCPEPG RFAVQSDVSCGATGALFHIGITNGVFWWTTMSICLFAVVKRIKLFDFRYFIIFNTTASLI SVIIPLAGNAFMAGTGSLACWIRKTWYVNSVFWIPCGIALTIGSVCIILVIYEIYKITKN VSTKDNRMILLQIKPFLCVTLVGGSFYYLFIFNFDNESHSKEYKEKVVDYVMCLLSDTGK ECLMAGPNYVAYFVFYFFIRLFGITFFCIYGTSQNARDIWIHSKILNHPNIKPFLLKYNI INFNSMTHYGSGTNPTSNSKNSKNNQNNQNNNSRKEFESKNIELEVNESISKGQTTRGAD DEEESNINSASNTSSD
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it used as a model organism?

Dictyostelium discoideum is a haploid social amoeba that shares many features with animal cells, making it an ideal model organism for studying fundamental cellular processes. Its haploid nature simplifies genetic manipulation and phenotypic analysis, as mutations immediately manifest without being masked by a second allele. D. discoideum is particularly valuable for studying basic processes such as cell locomotion, phagocytosis, and developmental signaling pathways . The organism transitions from a single-cell state to a multicellular structure during development, offering insights into cell differentiation and morphogenesis mechanisms. Additionally, its genome has been fully sequenced, facilitating genetic studies and molecular analyses.

What is the role of fslB in Dictyostelium discoideum?

The Frizzled and smoothened-like protein B (fslB) is a 634-amino-acid protein with a conserved serpentine structure characteristic of G protein-coupled receptors (GPCRs). It belongs to the serpentine receptor family in D. discoideum and plays critical roles in sensing environmental cues, regulating cell proliferation, and mediating chemotaxis during development. As a GPCR-like protein, fslB likely functions in signal transduction pathways that allow D. discoideum to respond to external stimuli and coordinate cellular behaviors during growth and development.

What is the difference between full-length and partial recombinant fslB protein?

The full-length fslB protein consists of the complete 634-amino-acid sequence encoded by the DDB_G0270111 gene, including all functional domains and structural elements. In contrast, the partial recombinant form represents a truncated version of the protein. This truncation typically focuses on preserving specific functional domains while removing regions that might interfere with protein expression, stability, or crystallization. Partial recombinant proteins are often preferred in structural studies and initial functional characterizations because they may be more stable and easier to work with than their full-length counterparts.

How does fslB compare structurally to other members of the Frizzled and Smoothened-like protein family?

The fslB protein contains the characteristic seven-transmembrane domain structure typical of GPCRs. Comparative analysis with other Frizzled and Smoothened-like proteins reveals conserved motifs involved in ligand binding and signal transduction. Unlike mammalian Frizzled receptors, D. discoideum fslB lacks the characteristic cysteine-rich domain (CRD) at the N-terminus. Instead, it features unique insertions in the extracellular loops that may contribute to ligand specificity in the D. discoideum signaling environment. The protein's cytoplasmic domains contain potential phosphorylation sites that likely regulate receptor activation and downstream signaling.

What signaling pathways interact with fslB in Dictyostelium discoideum?

Based on structural homology with other serpentine receptors, fslB likely interfaces with heterotrimeric G-proteins to initiate intracellular signaling cascades. The receptor may activate adenylyl cyclase pathways, leading to cAMP production that regulates chemotaxis during D. discoideum aggregation. Additionally, fslB potentially interacts with the phosphoinositide signaling pathway, affecting cytoskeletal rearrangements essential for cell movement. The receptor could also modulate calcium signaling, influencing cellular responses to environmental stimuli.

How does fslB function compare to bacteriolytic proteins like BadA in Dictyostelium?

While fslB functions primarily as a transmembrane receptor involved in environmental sensing and signal transduction, bacteriolytic proteins like BadA serve entirely different cellular functions. BadA belongs to a family of proteins containing the DUF3430 domain and has been shown to exhibit bacteriolytic activity against bacteria like Klebsiella pneumoniae . Unlike fslB, which mediates signaling at the cell surface, BadA appears to function within phagosomes, contributing to the destruction of ingested bacteria at acidic pH. This functional difference illustrates the diverse protein specializations that enable D. discoideum to both sense its environment (via fslB) and defend against bacterial pathogens (via BadA).

What are the optimal expression systems for producing recombinant fslB?

For recombinant fslB expression, several systems can be considered:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coliHigh yield, cost-effective, rapid growthMembrane proteins often misfold, lack post-translational modificationsUse specialized strains (C41/C43), fusion tags (MBP, SUMO), lower induction temperature (16-20°C)
Insect cellsBetter folding of eukaryotic proteins, post-translational modificationsHigher cost, longer production timeOptimize codon usage, use strong promoters, screen multiple cell lines
DictyosteliumNative environment, authentic post-translational modificationsLower yield, more complex cultivationUse inducible promoters, optimize growth conditions, consider knockout complementation

Selection of an appropriate expression system should be guided by the specific experimental requirements, such as protein yield needs, structural integrity concerns, and functional assay demands.

What strategies can enhance homologous recombination efficiency when genetically manipulating the fslB gene in Dictyostelium?

Enhancing homologous recombination efficiency when targeting the fslB gene in Dictyostelium can be achieved through several strategies. One approach involves using the loxP/Cre recombinase system, which has been shown to increase homologous recombination rates from 25% to approximately 80% at other loci . This method requires engineering a Dictyostelium line with a single loxP site adjacent to the fslB gene and then introducing replacement DNA containing a loxP site in a homologous position.

The process involves:

  • Creating a targeting construct with homology arms flanking the fslB gene

  • Incorporating a single loxP site and selectable marker

  • Transforming cells that express Cre recombinase

  • Screening transformants for successful recombination events

This approach significantly improves the efficiency of generating targeted mutations, insertions, or deletions in the fslB gene, facilitating functional studies of the protein.

What purification methods are most effective for isolating recombinant fslB protein?

Purification of recombinant fslB protein presents challenges due to its transmembrane nature. A multi-step purification protocol is recommended:

  • Membrane Preparation: Isolate total membranes through differential centrifugation after cell lysis.

  • Detergent Solubilization: Screen detergents for optimal solubilization using the following guidelines:

DetergentCritical Micelle ConcentrationProtein StabilityMicelle Size
DDM0.17 mMHighMedium
LMNG0.01 mMVery HighSmall
Digitonin~0.5 mMMediumLarge
  • Affinity Chromatography: Utilize nickel-NTA (for His-tagged protein) or anti-FLAG affinity resins (for FLAG-tagged constructs).

  • Size Exclusion Chromatography: Separate properly folded protein from aggregates and further remove contaminants.

For structural studies, consider additional steps such as anion exchange chromatography and lipid nanodisc reconstitution to maintain the protein in a native-like membrane environment.

How can researchers differentiate between specific and non-specific binding in fslB interaction studies?

Differentiating between specific and non-specific binding in fslB interaction studies requires multiple complementary approaches:

  • Competition Assays: Perform binding assays with increasing concentrations of unlabeled potential ligand. Specific interactions will show dose-dependent displacement of labeled ligand with a clear IC50 value.

  • Mutational Analysis: Generate targeted mutations in predicted binding sites of fslB. Specific interactions will be disrupted by mutations in critical residues while non-specific interactions remain largely unaffected.

  • Controls: Include structurally similar but functionally distinct proteins as negative controls. For fslB studies, other serpentine receptors from D. discoideum that are not expected to bind the ligand of interest can serve as controls.

  • Binding Parameter Analysis: Calculate binding parameters such as Kd, Bmax, and Hill coefficient. Specific interactions typically show saturable binding with Kd values in the physiologically relevant range.

  • Cross-linking Studies: Use chemical cross-linkers followed by mass spectrometry to identify direct binding partners, distinguishing them from proteins that co-purify but do not directly interact.

What phenotypic changes would be expected in fslB knockout or knockdown Dictyostelium strains?

Based on the known functions of serpentine receptors in D. discoideum, fslB knockout or knockdown strains would likely exhibit several phenotypic changes:

  • Chemotaxis Defects: Impaired ability to sense and move toward chemoattractants, manifesting as altered cell motility patterns and reduced directionality in gradient tracking assays.

  • Developmental Abnormalities: Delayed or aberrant progression through the developmental cycle, potentially affecting aggregation, mound formation, or fruiting body development.

  • Cell Proliferation Changes: Altered growth rates in axenic culture or on bacterial lawns, reflecting the role of fslB in regulating cell proliferation.

  • Signal Transduction Alterations: Modified activation patterns of downstream effectors such as adenylyl cyclase, guanylyl cyclase, or MAP kinases in response to stimuli.

  • Phagocytosis Efficiency: Potential changes in the rate or specificity of particle uptake, affecting the ability to grow on bacterial food sources.

These phenotypic alterations would provide insights into the physiological functions of fslB and its role in D. discoideum biology.

How can researchers overcome common challenges in generating stable fslB-expressing cell lines?

Generating stable fslB-expressing cell lines presents several challenges due to potential toxicity or instability of the recombinant protein. Researchers can implement the following strategies to overcome these issues:

  • Inducible Expression Systems: Utilize tetracycline-inducible or other conditional promoters to control expression levels and timing, reducing selection against high expressors.

  • Codon Optimization: Adapt the fslB coding sequence to the codon usage bias of the expression host to improve translation efficiency and reduce the formation of rare codon-induced pauses.

  • Fusion Partners: Incorporate stabilizing fusion partners such as GFP or MBP that can improve protein folding and provide a means to monitor expression levels.

  • Selection Strategy: Implement a dual selection strategy combining both antibiotic resistance and functional complementation in a knockout background to ensure maintenance of functional protein expression.

  • Cell Culture Conditions: Optimize growth conditions including temperature, media composition, and cell density to maximize stable expression while minimizing cellular stress.

What are the best approaches for studying protein-protein interactions involving fslB?

Several complementary approaches can be employed to study protein-protein interactions involving fslB:

  • Co-immunoprecipitation (Co-IP): For identifying native interaction partners from cellular extracts. This approach can be enhanced using crosslinking agents to stabilize transient interactions, particularly important for membrane proteins like fslB.

  • Proximity Labeling: Techniques such as BioID or APEX, where fslB is fused to a biotin ligase or peroxidase, respectively, can identify proteins in close proximity to fslB in living cells.

  • Förster Resonance Energy Transfer (FRET): For studying direct interactions and their dynamics in living cells by fusing fslB and potential partners with appropriate fluorophore pairs.

  • Yeast Two-Hybrid Variants: Modified membrane yeast two-hybrid systems specifically designed for membrane proteins can identify direct interactors.

  • Mass Spectrometry-Based Approaches: Quantitative proteomics comparing wild-type to fslB-depleted cells can identify altered protein complexes, while cross-linking mass spectrometry can map interaction interfaces.

When designing these experiments, it's crucial to consider the membrane-embedded nature of fslB and ensure that extraction and purification conditions maintain the protein's native conformation and interaction capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.