Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein C (fslC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize development to meet your requirements.
Synonyms
fslC; DDB_G0274287; Frizzled and smoothened-like protein C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-635
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslC
Target Protein Sequence
EILNEFGYGLVDENLKCLSFIGDSNNQQLCNNKLINKQLIYSTINKSNQIQSLKMVEQSF KQLTFLQGKCLNLNFAQFGICDIYFPSCVETSFGISLPKRLCKSVCKQIVTDCPTLGVSL NCSDSNKFPTIGTLYNLTKYGYTENNGFYQVECSNPTNYYYNEINSTNNQFIEICPSPLV LRNQSDSKYGEDKGYTYLSPTNCVLGCPQPFFKNNKWVQMYKMSIVLSTLSFICSIYNII TFGLLSKLKSKYNLCITFFSVSTVLMSLMDIVTYGIGYEELLCPESGRYAIQSDVACGVT GAFFHIGITTGVLWWTTMSICLYSEVKRFKMISFRYIIIFNSVISLILLIIPLSGQAFMS GNGSLGCWIRKTWYANGTFWIPCGISLFIGAICIVLVIYEIFKISRNLSKDNKPLMFQIR PFLCVLLVGGSFLYLFIFYFNNERNLDKYKAAIPSYVQCLLSSDENGEDCLTDGPGFGAY FTFYFFTRLFGITSFSIYGTSKIARDIWFESAYNHPFFNPYIVKCLSLLGISKHFSSNSI SGSNQKRFNRNGSNFNMKQNKSNPNDSISLSVVESTKKQDTENELESNIETKENRSTDIS IENTTSSKDSNTNSF
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum fslC and how does it relate to other Frizzled-like proteins?

Dictyostelium discoideum Frizzled and smoothened-like protein C (fslC) is a transmembrane protein functioning as a component of signaling pathways. While Dictyostelium does not possess direct homologs of mammalian Frizzled receptors that function in Wnt signaling pathways, it does contain Frizzled-like proteins that share structural similarities with both Frizzled and Smoothened receptors .

The fslC protein (UniProt ID: Q86J18) is one of several Frizzled and Smoothened-like proteins in Dictyostelium, containing characteristic domains similar to those found in the Frizzled receptor family . Unlike classical Frizzled proteins in metazoans that primarily function in Wnt signaling, the precise signaling role of fslC in Dictyostelium remains an area of active investigation.

How does the C-terminal domain of fslC compare to other Frizzled receptors?

Studies on Frizzled receptors have shown that the C-terminal domain contains a conserved motif (KTXXXW) that is critical for interaction with PDZ domain-containing proteins such as Dishevelled . This interaction is crucial for Wnt/β-catenin signaling.

In solution NMR studies of Frizzled C-terminal domains:

  • The peptide is unstructured in aqueous solution

  • Forms a helical structure in detergent micelles

  • The tryptophan residue interacts with micelles, suggesting membrane association

  • The structure forms an amphipathic helix similar to helix 8 in other GPCRs

While these studies were not conducted specifically on Dictyostelium fslC, they provide insight into potential structural characteristics that may be conserved across Frizzled family proteins.

What expression systems are most effective for producing recombinant fslC?

Expression SystemAdvantagesLimitationsUse Case for fslC
E. coliHigh yield, simple cultivation, cost-effectiveLimited post-translational modifications, potential inclusion body formationStructural studies, antibody production, protein-protein interaction assays
DictyosteliumNative post-translational modifications, secretion possible, proper foldingLower yields (1-20 mg/L), more complex cultivationFunctional studies requiring native modifications
Mammalian cellsComplex glycosylation, natural foldingHigh cost, lower yields, longer production timeStudies focusing on glycosylation patterns and membrane insertion

For optimal results with E. coli expression, researchers should consider:

  • Using BL21(DE3) or similar strains optimized for protein expression

  • Testing multiple induction temperatures (16-30°C)

  • Optimizing IPTG concentration and induction time

  • Including solubility-enhancing fusion tags alongside the His tag

Importantly, Dictyostelium itself can be used as an expression host for recombinant proteins, with yields of up to 20 mg/L for secreted proteins in peptone-based growth medium . This approach may be particularly valuable for functional studies of fslC.

What purification strategies yield the highest quality recombinant fslC?

Purification of His-tagged recombinant fslC can be achieved through immobilized metal affinity chromatography (IMAC) . A comprehensive purification workflow should include:

  • Initial capture:

    • Ni-NTA or TALON resin affinity chromatography using imidazole gradients

    • Buffer optimization to maintain protein stability (typically Tris/PBS-based buffer, pH 8.0)

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography for removing contaminating proteins

  • Quality assessment:

    • SDS-PAGE analysis (>90% purity is typically achievable)

    • Western blotting with anti-His antibodies

    • Mass spectrometry to confirm intact protein mass

  • Storage considerations:

    • Addition of 6% trehalose as a stabilizing agent

    • Aliquoting to avoid freeze-thaw cycles

    • Storage at -20°C/-80°C for long-term preservation

    • Addition of 5-50% glycerol for enhanced stability during freezing

When reconstituting lyophilized protein, researchers should use deionized sterile water to a concentration of 0.1-1.0 mg/mL and consider adding glycerol to a final concentration of 50% for long-term storage .

How can I investigate the membrane localization and trafficking of fslC?

Investigating the membrane localization and trafficking of fslC requires specialized techniques that have been successfully applied to other Dictyostelium proteins:

  • Fluorescent protein tagging:

    • Generate constructs with GFP or other fluorescent tags fused to fslC

    • Expression vectors that enable studies on protein localization and function in Dictyostelium are available

    • Consider C-terminal tagging to preserve potential N-terminal signal sequences

  • Live-cell imaging:

    • Confocal microscopy to track protein movement

    • TIRF microscopy for analyzing membrane dynamics

    • FRAP (Fluorescence Recovery After Photobleaching) to study protein mobility

  • Subcellular fractionation:

    • Density gradient centrifugation to isolate membrane fractions

    • Western blotting using recombinant antibodies specific to Dictyostelium proteins

  • Co-localization studies:

    • Use established markers for cellular compartments in Dictyostelium

    • Available markers include those for mitochondria, Golgi apparatus, endolysosomal compartments, cytoskeleton, and contractile vacuole

For Frizzled-like proteins, particular attention should be paid to the C-terminal domain, which in other Frizzled proteins has been shown to form a helix that interacts with the membrane through a conserved tryptophan residue .

What approaches can effectively determine the signaling pathways involving fslC?

Understanding the signaling roles of fslC requires multi-faceted approaches:

  • Gene expression analysis:

    • RNA sequencing to identify transcriptional changes in response to fslC manipulation

    • Similar to approaches used to study Dictyostelium responses to bacteria

    • Compare wild-type and fslC-mutant cells under various conditions

  • Protein-protein interaction studies:

    • Immunoprecipitation followed by mass spectrometry to identify interacting partners

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

    • Focus on potential interactions with PDZ domain-containing proteins, similar to the interactions observed with other Frizzled receptors

  • Functional assays:

    • Chemotaxis assays to evaluate motility changes

    • Development assays observing the multicellular developmental phase

    • Phagocytosis and macropinocytosis assays

    • Cell-substrate and cell-cell adhesion measurements

  • Pathway inhibitor studies:

    • Test inhibitors of conserved signaling components (e.g., GSK3β inhibitors)

    • Evaluate whether these modify phenotypes associated with fslC manipulation

Since Dictyostelium development shares many common features with metazoan development but occurs in a shorter timeframe, developmental phenotypes can be rapidly detected and analyzed .

How can CRISPR-based gene disruption be applied to study fslC function?

CRISPR-based gene disruption has been successfully applied in Dictyostelium and can be utilized to study fslC function:

  • CRISPR design considerations:

    • Target sequences within the coding region of fslC

    • Design guide RNAs with minimal off-target potential

    • Select appropriate Cas9 variants (e.g., high-fidelity versions to reduce off-target effects)

    • As noted in search results, CRISPR-based gene disruption methods have been specifically developed for Dictyostelium

  • Verification of knockout efficiency:

    • PCR amplification and sequencing of the target region

    • Western blotting using antibodies against fslC

    • RT-PCR to confirm absence of transcript

  • Phenotypic analysis of fslC knockout:

    • Growth rate in axenic medium and on bacterial lawns

    • Development timing and morphology

    • Cell motility and chemotaxis

    • Phagocytosis and macropinocytosis efficiency

  • Complementation studies:

    • Reintroduction of wild-type fslC to confirm phenotype rescue

    • Introduction of mutated versions of fslC (e.g., with modifications in key domains)

    • Use of inducible expression systems to control timing of complementation

The haploid genome of Dictyostelium facilitates the introduction of gene disruptions, and phenotypic outcomes can be readily measured in this multicellular organism .

What phenotypic assays are most informative for characterizing fslC mutants?

When characterizing fslC mutants, researchers should focus on phenotypic assays that reveal potential functions in signaling and development:

  • Development assays:

    • Monitor the 24-hour multicellular developmental cycle

    • Document timing of developmental stages

    • Analyze fruiting body morphology

    • Assess spore formation and viability

    • These approaches have been informative for other signaling proteins in Dictyostelium

  • Cell behavior assays:

    • Chemotaxis toward folate and cAMP

    • Random motility measurements

    • Phototaxis and thermotaxis responses

    • Cell-substrate adhesion

    • These phenotypes have been used to characterize mitochondrial dysfunction and may reveal signaling roles of fslC

  • Bacterial interaction assays:

    • Co-culture with various bacterial species

    • Analysis of phagocytosis rates

    • Gene expression changes in response to bacteria

    • Similar to approaches used to study transcriptional responses to bacteria

  • Group size regulation:

    • Analysis of streaming during aggregation

    • Measurement of group size during development

    • These processes involve cell-cell communication and adhesion, which may be influenced by fslC

A rigorous phenotypic analysis should include quantitative measurements and statistical analysis of multiple independent experiments to establish reproducible phenotypes associated with fslC mutation.

How can recombinant antibodies against fslC be developed and utilized?

Development of recombinant antibodies specific to fslC would significantly advance research capabilities:

  • Antibody development strategies:

    • Hybridoma sequencing approach: Generate monoclonal antibodies and determine antibody sequences

    • Phage display technology: Select antibodies from synthetic or natural libraries

    • Both approaches have been successfully applied to generate antibodies against Dictyostelium proteins

  • Expression formats:

    • Single-chain variable fragments (scFv)

    • Full antibodies with mouse or rabbit Fc regions

    • Fusion with tags or fluorochromes for specialized applications

    • Researchers have successfully converted hybridoma-derived antibodies to recombinant formats for Dictyostelium antigens

  • Validation methods:

    • Immunofluorescence comparing original and recombinant antibodies

    • Western blotting with wild-type and knockout cells

    • Immunoprecipitation followed by mass spectrometry

  • Research applications:

    • Protein localization via immunofluorescence

    • Protein quantification via western blotting

    • Protein complex isolation via immunoprecipitation

    • Pull-down assays to identify interacting partners

Recombinant antibodies offer advantages including permanent storage in plasmid form, consistent reproducibility, and flexibility in format (e.g., with different tags or Fc regions) .

How does fslC function relate to human Frizzled receptors and disease models?

Understanding the relationship between Dictyostelium fslC and human Frizzled receptors could provide insights into disease mechanisms:

  • Comparative structural analysis:

    • Alignment of conserved domains between fslC and human Frizzled receptors

    • Focus on the cysteine-rich domain and C-terminal regions

    • Examine conservation of key motifs such as the KTXXXW sequence found in human Frizzled C-termini

  • Functional complementation studies:

    • Expression of human Frizzled in fslC-null Dictyostelium

    • Assessment of phenotypic rescue

    • Analysis of downstream signaling activation

  • Disease-relevant applications:

    • Introduction of disease-associated mutations from human Frizzled receptors into corresponding regions of fslC

    • Analysis of effects on localization, stability, and function

    • Screening for compounds that modulate mutant protein function

  • Mitochondrial dysfunction models:

    • Evaluate whether fslC mutations affect mitochondrial function

    • Assess phenotypes characteristic of mitochondrial dysfunction in Dictyostelium:

      • Impaired phototaxis and thermotaxis

      • Growth defects in axenic medium and on bacterial lawns

      • Chronic activation of AMP kinase

      • Altered stalk formation

      • These phenotypes have been useful in studying neurodegenerative disease proteins in Dictyostelium

While Dictyostelium does not encode a homolog of α-synuclein (associated with Parkinson's disease), studies have shown that expressing α-synuclein in Dictyostelium affects mitochondrial function . Similar approaches could be applied to study interactions between fslC and disease-associated proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.