Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein D (fslD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
fslD; DDB_G0269528; Frizzled and smoothened-like protein D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-634
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslD
Target Protein Sequence
QNSLNDYGFGIVDESSICTSYIGDELCKNRLSNSESIYTTPGGGGGGGIDKLSQISTLPI LQKGFQSLTFSQGICKDLNFIEFGMCDSALSPCIETTPKITPGYNISLPQRVCKSVCERM LIGCPQLAIQIDCSISFLFPKIGTFYNLTKYGYTANGGMYMVPCIDTEINYEKNKVQENV GFLESCPYPLLLKNSTDPQYAEKRGYTYLTPTNCVLPCPIPNYTKRQMDSVINMSKAMSS ISFVLSLFNVITFGLLIKKKSKYNVCIALMAIGSSFIYLSDIINYGVGIEKQLCPEPGRV ATQRVDSLCGFTGSIFHIGITLCVLWSMTMGIVLYSKIKQFKLPNFRYFLIGNLSFTVVT LIILASAKKFQGGNGFLECWMRDRWYVVAIFWIPCGIALLLGVLSICGVIFEIYKISKNV SLKDSKVVIRELKPFVLVVTVSASLIYLFVFYFDSESKYDFYKKGVEDYILCLLTSENPL DECYTVGPNFNSYFMFYFLIRFFGILFFGIFGTSEIARNAWTESFFVTKIKSKISITTVS SSTRGGGGDTSGIKSSSSSSNSGVCNNNNSTRKNYGDDFNSKNLSQPDNTIITNNNNNDN NNKMEIELDSIDI
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a model organism?

Dictyostelium discoideum is a cellular slime mold widely used in research due to its simple life cycle and experimental tractability. It offers significant advantages as a model organism for studying fundamental cellular processes, including cell signaling, differentiation, and developmental biology. D. discoideum undergoes a well-characterized developmental process when starved, transitioning from single-cell amoebae to a multicellular structure, providing researchers with a system to study cell-cell communication and differentiation in a relatively simple context . The organism maintains a haploid genome that facilitates genetic manipulation and clear phenotypic analysis of mutations .

Methodologically, working with D. discoideum offers several advantages:

  • Simple laboratory maintenance and rapid growth cycle

  • Accessible genetic manipulation through various techniques

  • Conservation of many signaling pathways found in higher eukaryotes

  • Ability to study both unicellular and multicellular stages

  • Absence of complex tissues allowing clearer analysis of molecular mechanisms

How does fslD relate to mammalian Frizzled and Smoothened proteins?

The Frizzled and smoothened-like protein D (fslD) in Dictyostelium discoideum shows structural and functional similarities to mammalian Frizzled and Smoothened proteins, which are key components of the Wnt and Hedgehog signaling pathways, respectively. While D. discoideum does not possess canonical Wnt or Hedgehog pathways as found in mammals, it contains proteins with conserved domains that suggest evolutionary relationships to these important signaling components.

Similar to how D. discoideum Roco kinases function as homologs of human LRRK2 (with Roco4 showing the highest structural similarity) , fslD likely represents an evolutionary precursor that shares functional domains with both Frizzled and Smoothened receptor families. This makes it particularly valuable for studying the ancestral functions of these signaling pathways before they diverged in more complex organisms.

What expression systems are most effective for producing recombinant fslD?

For recombinant expression of D. discoideum proteins like fslD, several expression systems have proven effective, each with distinct advantages:

D. discoideum expression system:

  • Maintains native post-translational modifications

  • Allows for studying protein function in its natural cellular context

  • Can be achieved through integration of expression vectors containing an actin promoter

  • Most suitable when protein folding and glycosylation patterns are critical

E. coli expression system:

  • Provides high yield production for structural studies

  • Best for truncated versions focusing on specific domains

  • Typically requires optimization of codon usage and expression conditions

  • May require refolding protocols to obtain functional protein

Insect cell system (such as Sf9 cells):

  • Balances higher eukaryotic processing with reasonable yields

  • Particularly effective for membrane proteins like fslD

  • Baculovirus expression vectors allow for controlled induction

  • Often provides better folding than bacterial systems

For functional studies, expressing fslD in D. discoideum cells lacking the endogenous gene (fslD⁻ cells) allows direct assessment of protein function through rescue experiments, similar to approaches used with other D. discoideum proteins like AprA .

How can we optimize purification protocols for recombinant fslD to maintain structural integrity?

Purification of recombinant membrane proteins like fslD requires careful consideration of detergents and buffer conditions to maintain structural integrity. Based on protocols developed for similar D. discoideum proteins, a recommended methodological approach includes:

  • Membrane fraction isolation:

    • Harvest cells and disrupt using mechanical methods (French press or sonication)

    • Separate membrane fraction through differential centrifugation

    • Wash membranes to remove peripheral proteins

  • Solubilization optimization:

    • Screen detergents systematically (start with mild detergents like DDM, LMNG, or GDN)

    • Optimize detergent:protein ratio through small-scale experiments

    • Include stabilizing agents like cholesterol hemisuccinate if needed

  • Affinity purification:

    • Use poly-histidine or other affinity tags positioned to minimize interference with protein function

    • Incorporate protease inhibitor cocktails throughout purification

    • Maintain consistent temperature (typically 4°C) throughout process

  • Quality assessment:

    • Employ size exclusion chromatography to evaluate monodispersity

    • Use circular dichroism to confirm secondary structure integrity

    • Verify functionality through binding assays with putative ligands

When comparing different detergent systems for fslD purification, researchers should collect data in the following format:

DetergentConcentrationSolubilization Efficiency (%)Monodispersity IndexFunctional Activity (%)
DDM1%750.8265
LMNG0.1%680.9178
GDN0.05%700.8872

This systematic approach enables identification of optimal conditions for structural and functional studies.

What are the key domains in fslD and how do they contribute to its function?

Frizzled and smoothened-like proteins typically contain several conserved domains that are critical for their function. For fslD in D. discoideum, domain analysis and mutation studies provide insights into structure-function relationships:

  • N-terminal cysteine-rich domain (CRD):

    • Likely involved in ligand binding

    • Contains conserved cysteine residues forming disulfide bonds

    • Mutations in this region typically affect ligand recognition

  • Seven-transmembrane domain:

    • Forms the core of the receptor structure

    • Contains residues involved in signal transduction

    • Key for interaction with downstream signaling partners

  • Intracellular loops and C-terminal tail:

    • Critical for G-protein coupling and downstream signaling

    • Contains potential phosphorylation sites for regulation

    • May interact with scaffolding proteins

Domain function can be studied through deletion and point mutation analysis, with effects assessed by expressing mutant proteins in fslD⁻ cells and evaluating phenotypic rescue, similar to how GrlH receptor function was studied in D. discoideum . For example, researchers found that expression of GrlH in grlH⁻ cells (grlH⁻/grlH OE) rescued phenotypes related to proliferation and chemorepulsion .

How does fslD signaling integrate with other pathways in D. discoideum development?

The integration of fslD signaling with other developmental pathways in D. discoideum likely involves complex interactions similar to those observed with other signaling systems in this organism. Methodologically, researchers can approach this question through:

  • Transcriptomic analysis:

    • Compare gene expression profiles between wild-type and fslD⁻ cells during development

    • Identify differentially expressed genes in key developmental pathways

    • Use RNA-seq at multiple developmental timepoints to construct signaling networks

  • Protein interaction studies:

    • Perform immunoprecipitation followed by mass spectrometry to identify binding partners

    • Use proximity labeling techniques (BioID or APEX) to map the protein interaction landscape

    • Validate key interactions through co-immunoprecipitation and FRET analysis

  • Genetic interaction screens:

    • Create double mutants with fslD⁻ and other pathway components

    • Analyze synthetic phenotypes that suggest pathway interactions

    • Use CRISPR-Cas9 to generate systematic knockout libraries

Similar to how presenilin proteins in D. discoideum have been found to control development with functions conserved in human homologues , fslD likely participates in developmental signaling networks with potential relevance to mammalian systems.

How should knockout and knockin experiments for fslD be designed to minimize off-target effects?

Designing precise genetic manipulation experiments for fslD requires careful consideration of specificity, efficiency, and validation. A comprehensive experimental design should include:

  • Target selection and validation:

    • Analyze gene structure to identify unique regions for targeting

    • Verify target sequence uniqueness through genome-wide BLAST analysis

    • Design multiple guide RNAs or targeting constructs to compare efficiency

  • Construction of knockout vectors:

    • For homologous recombination approach:

      • Include 5' and 3' homology arms (typically 1-2 kb each)

      • Insert selection marker (e.g., Blasticidin resistance cassette)

      • Consider using loxP sites for marker removal if needed

    • For CRISPR-Cas9 approach:

      • Design guide RNAs with minimal off-target potential

      • Optimize Cas9 expression for D. discoideum

      • Prepare repair templates with appropriate homology arms

  • Screening and validation:

    • PCR-based screening to identify successful integration events

    • RT-qPCR and Western blot to confirm absence of transcript and protein

    • Whole-genome sequencing or targeted sequencing of potential off-target sites

    • Phenotypic rescue experiments with wild-type fslD to confirm specificity

  • Control experiments:

    • Compare multiple independent clones to ensure consistency

    • Include wild-type controls processed in parallel

    • Consider creating revertant strains to control for off-target effects

This systematic approach helps ensure that observed phenotypes are specifically due to fslD manipulation rather than off-target effects, following established principles for experimental design in genetic studies .

What controls are essential when studying fslD-mediated signaling pathways?

When investigating fslD-mediated signaling pathways, rigorous controls are necessary to ensure experimental validity:

  • Genetic controls:

    • Wild-type parental strain as positive control

    • fslD knockout strain as negative control

    • Rescue strain (fslD⁻/fslD) to confirm phenotype specificity

    • Domain mutants to delineate structure-function relationships

  • Treatment controls:

    • Vehicle controls for all chemical treatments

    • Concentration gradients to establish dose-response relationships

    • Time-course experiments to capture dynamic signaling events

    • Pathway inhibitor controls to validate signal specificity

  • Technical controls:

    • Loading controls for Western blots (consider using streptavidin conjugates for D. discoideum)

    • Housekeeping genes for RT-qPCR normalization

    • Randomization of sample processing to minimize batch effects

    • Blinding of analysis where subjective assessments are involved

  • Validation across methods:

    • Confirm key findings using orthogonal techniques

    • Employ both genetic and pharmacological approaches

    • Utilize both overexpression and loss-of-function experiments

For signaling pathway analysis, researchers should document activation patterns using quantitative measurements, similar to how AprA signaling was characterized in D. discoideum , ensuring all experiments include appropriate controls for signal specificity.

How can researchers distinguish between direct and indirect effects of fslD manipulation?

Distinguishing direct from indirect effects is a critical challenge when manipulating signaling components like fslD. A comprehensive methodological approach includes:

  • Temporal analysis:

    • Implement time-course experiments to capture immediate vs. delayed responses

    • Use rapid induction systems (e.g., inducible promoters) to identify primary effects

    • Compare short-term (minutes to hours) vs. long-term (hours to days) consequences

  • Proximity-based approaches:

    • Apply proximity labeling methods to identify direct interaction partners

    • Use split reporter systems to visualize protein-protein interactions in vivo

    • Implement FRET sensors to detect direct molecular interactions

  • Biochemical validation:

    • Perform in vitro binding assays with purified components

    • Use surface plasmon resonance to quantify direct binding

    • Implement cross-linking approaches followed by mass spectrometry

  • Genetic epistasis analysis:

    • Create double and triple mutants in putative pathway components

    • Analyze phenotypes to establish hierarchical relationships

    • Use synthetic genetic array approaches for systematic interaction mapping

This multi-pronged approach helps build a comprehensive understanding of fslD signaling, similar to how researchers have delineated the functions of DIFs in D. discoideum, distinguishing their direct effects on differentiation from their roles in chemotaxis .

How can fslD research contribute to understanding evolutionary conservation of signaling pathways?

Research on D. discoideum fslD offers unique insights into the evolutionary origins and conservation of Frizzled and Smoothened-related signaling pathways. Methodological approaches to investigate evolutionary aspects include:

  • Comparative genomics:

    • Perform phylogenetic analysis across diverse taxa to trace evolutionary relationships

    • Identify conserved motifs and domains across species

    • Map conservation patterns to functional regions

  • Functional complementation studies:

    • Express fslD in mammalian cells lacking Frizzled or Smoothened

    • Test for rescue of signaling functions

    • Analyze which domains are essential for cross-species functionality

  • Structural biology approaches:

    • Determine the structure of fslD using cryo-EM or X-ray crystallography

    • Compare structural features with mammalian counterparts

    • Identify conserved binding pockets and interaction surfaces

The evolutionary insights gained from fslD research may parallel discoveries made with other D. discoideum proteins, such as the demonstration that human Psen1 can rescue the developmental block in D. discoideum presenilin double mutants, confirming functional homology across vast evolutionary distances .

What potential does fslD have as a target for drug discovery and therapeutic development?

While primarily a basic research subject, fslD studies may yield insights relevant to drug discovery, particularly given D. discoideum's emerging role as a source of pharmacologically active compounds. Methodological approaches include:

  • High-throughput screening platforms:

    • Develop cell-based assays monitoring fslD activation or inhibition

    • Screen compound libraries for modulators of fslD signaling

    • Implement phenotypic screens focused on developmental processes

  • Structure-based drug design:

    • Use structural data to identify potential binding pockets

    • Perform in silico docking studies to identify potential ligands

    • Design targeted libraries based on structural insights

  • Comparative pharmacology:

    • Test whether compounds active against mammalian Frizzled/Smoothened affect fslD

    • Identify conserved pharmacophores across evolutionary distance

    • Use evolutionary insights to predict cross-reactivity

This approach mirrors how other D. discoideum compounds have been developed for pharmacological applications. For instance, differentiation-inducing factor-1 (DIF-1), originally isolated from D. discoideum as a stalk-cell differentiation inducer, has shown promising activity against various cancer cell lines, demonstrating how basic research in this organism can lead to potential therapeutic applications .

How can quantitative imaging techniques advance our understanding of fslD dynamics?

Advanced imaging techniques offer powerful tools for studying the dynamics of signaling proteins like fslD. Methodological considerations include:

  • Live-cell imaging approaches:

    • Generate fluorescent protein fusions that maintain fslD functionality

    • Implement photoactivatable or photoconvertible tags for pulse-chase experiments

    • Use FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

  • Super-resolution microscopy:

    • Apply techniques like PALM, STORM or STED to visualize nanoscale distribution

    • Track single molecules to identify distinct subpopulations

    • Map protein clustering dynamics during signaling events

  • Quantitative image analysis:

    • Develop automated segmentation algorithms for tracking protein localization

    • Implement correlation analysis to identify co-localization with interaction partners

    • Use machine learning approaches to identify subtle phenotypic changes

  • Biosensor development:

    • Design FRET-based sensors to detect fslD activation states

    • Create split fluorescent protein systems to visualize protein interactions

    • Develop optogenetic tools to manipulate fslD activity with light

Similar to how researchers have tracked the localization of γ-secretase complex components in D. discoideum to the endoplasmic reticulum , advanced imaging of fslD could reveal important insights about its subcellular distribution and dynamics during signaling events.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.