Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein E (fslE)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

fslE is produced recombinantly in E. coli systems, enabling high-yield synthesis for research applications . Key production parameters include:

ParameterSpecification
Expression HostE. coli
Purity>90% (verified by SDS-PAGE) .
Storage ConditionsTris/PBS-based buffer with 6% trehalose; store at -20°C/-80°C .
ReconstitutionRecommended in sterile water with 5–50% glycerol to prevent aggregation .

Repeated freeze-thaw cycles are discouraged to maintain stability .

Functional Insights

fslE is part of an evolutionarily conserved signaling network in Dictyostelium, sharing homology with animal GPCRs involved in developmental processes . Key roles include:

  • Cell Signaling: Likely participates in chemotaxis and aggregation during the amoeba’s multicellular development phase .

  • Evolutionary Significance: The presence of Frizzled/Smoothened-like proteins in Dictyostelium suggests early evolutionary origins of GPCR-mediated signaling, predating the divergence of animals and fungi .

Studies highlight its interaction with cytoskeletal regulators and ABC transporters, implicating fslE in coordinating motility and environmental response .

Research Applications

fslE is utilized in diverse experimental contexts:

ApplicationUse Case
ELISA AssaysDetecting protein-ligand interactions due to its tagged structure .
Structural StudiesInvestigating GPCR-like topology via crystallography or cryo-EM .
Comparative GenomicsAnalyzing evolutionary conservation of signaling pathways .

Its recombinant form is commercially available for biochemical studies, though not approved for human therapeutics .

Key Research Findings

  • Genomic Context: The fslE gene (DDB_G0288269) is part of a larger family of Dictyostelium GPCRs, including paralogs like fscH and fslK, which exhibit divergent ligand-binding properties .

  • Pathway Interactions: fslE’s interaction with cellulose synthase-associated proteins suggests a role in extracellular matrix organization, akin to SP65 in spore coat assembly .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
fslE; DDB_G0288269; Frizzled and smoothened-like protein E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-609
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslE
Target Protein Sequence
ENNEYSKGYGVGIVFPGSKCLNYVGDSIGQPLCNNRLFNGGKKIYSTVTLVDNKNISSQE LSKIEILKSFEALTFLQDQCDDLLFTQFGLCDLNFSPCVETIPKITPLQNVSLPQRLCKS VCERMVSNCPRLSLKIDCSISFLFPEIGTEYNLTLYGYTENKGLYKVPCIDPTDGYNNIS NQMELIQACPYPLLLKNSSDPKYSPNKGYTYLPPTNCVLTCPMPNYTKTQWKRVYDMAKT LSSISFICACYNILTFGILNRKRKSKYNICITLMSTSIALVYLTDIIKFGYGIEEFLCPE PGRSAVQNDAACGITGAMFHFGITYCCCWAMTMSIVLFCSVKRIKLFYFRHFMIGNTIFT IITTVILLSAKKMVAGTGYIECWVRERWFVITLFWLPCGIGLSIGIFCIGGVIHEIYNIS KKVNIRESEFILRQIKPFSLVFSVAGSFLYLFIFFFDVERKIDSYKAAVADYVLCLLSGG SEETCFTTGPNYASFFIFYFFIRVFGVLFFSIYGTSRVARDIWSEVVFDEVRSRLSQSES GISRNNSRTDISFGKNNNSKNSNNSKNSNNSKNSNNSDNDSKSIELEKK
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What makes Dictyostelium discoideum a suitable model organism for protein expression studies?

Dictyostelium discoideum offers several advantages as a model system for recombinant protein expression. As a eukaryotic organism with a haploid genome, it combines the simplicity of microbial culture techniques with the sophisticated cellular machinery needed for complex protein processing. D. discoideum can be grown axenically in its amoebal form and has demonstrated efficient secretion of recombinant proteins, with yields reaching up to 20mg/L for some proteins in standard peptone-based growth media . The organism's genome is amenable to diverse genetic manipulations, facilitating both expression system optimization and investigation of protein function . Additionally, D. discoideum properly processes many post-translational modifications, correctly cleaving secretion signal peptides from recombinant proteins as demonstrated with proteins like PsA and GST .

How does Dictyostelium discoideum's developmental cycle influence recombinant protein expression?

Dictyostelium discoideum's unique developmental cycle progresses from single-celled amoebae to multicellular structures under starvation conditions. For optimal recombinant protein production, researchers typically maintain cultures in the unicellular amoebal phase by ensuring adequate nutrient availability. During this growth phase, cultures should be maintained at approximately 5 × 10^6 cells/ml ± 20% through daily dilution with appropriate media such as HL-5 . When designing expression systems, consideration must be given to whether the target protein should be produced during the growth phase or if developmental-stage-specific promoters would be more appropriate for proteins that might interfere with normal cellular functions.

What expression systems are most effective for producing recombinant fslE in Dictyostelium discoideum?

Based on successful approaches with similar proteins in D. discoideum, effective expression systems for recombinant fslE typically employ strong constitutive promoters such as the actin 15 promoter. Vector design should include appropriate selection markers (commonly G418 resistance) and signal sequences if secretion is desired. For fslE expression, researchers should consider:

Table 1: Optimization Parameters for fslE Expression in D. discoideum

ParameterRecommended ApproachNotes
PromoterActin 15 promoterStrong constitutive expression during growth phase
Signal sequenceNative D. discoideum sequenceEnsures proper processing if secretion is desired
Selection markerG418 resistanceAllows for stable transformant selection
Codon optimizationMatch D. discoideum biasImproves translation efficiency
Culture conditions20°C in HL-5 mediumMaintain at 5 × 10^6 cells/ml ± 20%

The expression system should be validated by monitoring protein production over time, with stable expression demonstrated for at least 100 generations in the absence of selection, as shown with other recombinant proteins in D. discoideum .

What purification strategies are most effective for recombinant fslE?

Purification of recombinant fslE will depend on whether the protein is secreted or cell-associated. Drawing from experiences with similar proteins:

For secreted proteins:

  • Culture supernatant should be harvested by centrifugation at 500 × g for 2 minutes to separate cells.

  • Employ affinity chromatography if the recombinant fslE contains an affinity tag (His-tag, GST-tag).

  • Consider ion-exchange chromatography based on fslE's predicted isoelectric point.

  • Final polishing can be achieved using size-exclusion chromatography.

For cell-associated proteins:

  • Harvest cells by centrifugation and lyse using 0.4-1% Triton X-100 as demonstrated effective with D. discoideum .

  • Clear lysate by centrifugation at higher speeds (10,000-20,000 × g).

  • Follow similar chromatography steps as for secreted proteins.

How does the structure of fslE compare to fslF and other Frizzled and smoothened-like proteins in D. discoideum?

While specific structural data for fslE is not provided in the search results, we can infer some characteristics by examining the related fslF protein. The fslF protein contains multiple functional domains including extracellular cysteine-rich domains characteristic of Frizzled receptors . Based on patterns observed in protein families, fslE likely shares some structural elements with fslF while maintaining distinctive features that define its specific function.

Key structural elements to investigate in fslE would include:

  • Presence and arrangement of cysteine-rich domains

  • Transmembrane domains

  • Intracellular signaling motifs

  • Potential glycosylation sites

Comparative sequence analysis between fslE and fslF can provide insights into conserved functional domains and unique structural features that may influence ligand binding specificity and downstream signaling pathways.

What experimental approaches can reveal the functional role of fslE in Dictyostelium discoideum development?

To elucidate the functional role of fslE, researchers should consider these methodological approaches:

  • Gene disruption studies: Create knockout mutants of the fslE gene to observe developmental phenotypes. These can be generated using established D. discoideum transformation techniques.

  • Protein localization: Express fluorescently tagged fslE to track its subcellular localization throughout the developmental cycle using confocal microscopy.

  • Overexpression analysis: Create strains overexpressing fslE to identify gain-of-function phenotypes.

  • Binding partner identification: Employ pull-down assays or yeast two-hybrid screens to identify proteins that interact with fslE.

  • Developmental rescue experiments: Determine if fslE expression can rescue developmental defects in mutant strains.

D. discoideum's experimental tractability allows for sophisticated genetic approaches that would be challenging in more complex organisms, making it ideal for dissecting protein function in developmental pathways .

How can fslE be used to study neurological disorder mechanisms in a Dictyostelium discoideum model system?

Dictyostelium discoideum has proven valuable for studying neurological disorders through expression of human disease-associated proteins or their D. discoideum orthologs . For studying fslE in this context:

  • Pathway conservation analysis: Determine if fslE participates in signaling pathways conserved between D. discoideum and humans, particularly those related to Wnt signaling which involves Frizzled receptors.

  • Disease-relevant phenotypes: Establish whether fslE disruption creates cellular phenotypes analogous to those seen in neurological disorders, such as protein aggregation, mitochondrial dysfunction, or altered calcium signaling.

  • Drug screening platform: Develop high-throughput assays based on fslE-associated phenotypes to screen potential therapeutic compounds.

  • Interaction with disease proteins: Express human neurological disease proteins (such as those associated with Alzheimer's, Parkinson's, or Huntington's disease) in D. discoideum and investigate their interactions with fslE or fslE-dependent pathways .

These approaches leverage D. discoideum's simplicity while capitalizing on conserved molecular mechanisms relevant to human disease pathology.

What considerations are important when designing experiments to study the role of fslE in cell-cell signaling?

When investigating fslE's role in cell-cell signaling, researchers should address:

  • Temporal expression analysis: Quantify fslE expression levels throughout D. discoideum's developmental cycle using qRT-PCR or RNA-seq to identify critical timepoints.

  • Chimeric organism studies: Create mixed populations of wild-type and fslE-mutant cells labeled with different fluorescent markers to observe if cell sorting or differential developmental fates occur, indicating potential cell-cell signaling defects.

  • Extracellular vesicle analysis: Determine if fslE is present in extracellular vesicles, which serve as important signaling mediators in D. discoideum development.

  • Calcium signaling measurements: Monitor calcium flux in response to stimuli in wild-type versus fslE-mutant cells, as calcium signaling is often downstream of Frizzled-mediated pathways.

  • Single-cell transcriptomics: Apply single-cell RNA-seq to identify cell populations with differential responses to fslE signaling during multicellular development.

These experimental approaches should be designed with appropriate controls and statistical power to detect potentially subtle signaling phenotypes.

What are common challenges in expressing functional recombinant fslE and how can they be addressed?

Researchers may encounter several technical challenges when working with recombinant fslE:

Table 2: Common Challenges and Solutions for fslE Expression

ChallengePotential SolutionsMechanism
Low expression yieldsOptimize codon usage for D. discoideumImproves translation efficiency
Use stronger promotersIncreases transcription rate
Optimize culture conditions (temperature, media composition)Creates optimal cellular environment
Protein misfoldingExpress as fusion with solubility-enhancing tagsPromotes proper folding
Lower expression temperature to 18-20°CSlows folding process
Co-express with relevant chaperonesAssists proper folding
Protein degradationAdd protease inhibitors during purificationPrevents proteolytic degradation
Design constructs lacking protease-sensitive sitesReduces susceptibility to proteases
InsolubilityOptimize detergent selection for membrane proteinsMaintains native-like environment
Use mild solubilization conditionsPreserves structural integrity

Additionally, if the recombinant fslE is toxic to D. discoideum, researchers might consider using inducible expression systems or expression during specific developmental stages when the protein might be less disruptive to cellular processes.

How can researchers validate the proper folding and functionality of recombinant fslE?

Validating proper folding and functionality of recombinant fslE requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy: Analyze secondary structure content to confirm proper folding.

  • Limited proteolysis: Properly folded proteins typically show discrete, resistant fragments upon mild protease treatment.

  • Thermal shift assays: Monitor protein stability through denaturation curves.

  • Ligand binding assays: Develop assays to test binding to putative ligands or known binding partners of Frizzled-like proteins.

  • Functional complementation: Test if the recombinant protein can rescue phenotypes in fslE-deficient D. discoideum strains.

  • Activity assays: Measure downstream signaling events known to be activated by Frizzled-like receptors, such as β-catenin translocation or calcium flux.

These validation approaches should be combined to provide comprehensive evidence of proper protein folding and functionality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.