Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein F (fslF)

Shipped with Ice Packs
In Stock

Description

Production and Purification Protocols

Expression and Yield

  • Host Organism: E. coli (preferred for full-length expression) or yeast (partial-length) .

  • Tagging: His-tag facilitates affinity chromatography purification .

  • Purity: >90% as determined by SDS-PAGE (E. coli-derived) ; >85% for yeast-expressed partial constructs .

Comparative Analysis of Recombinant Constructs

SourceConstruct TypePurityApplications
E. coli Full-length, His-tagged>90%Structural studies, ELISA
Yeast Partial-length>85%Functional assays

Biochemical and Biophysical Properties

Stability and Handling

  • Thermal Stability: Optimal storage at -20°C/-80°C to prevent degradation .

  • Buffer Composition: Tris/PBS-based buffers with trehalose or glycerol stabilize the protein during storage .

Key Challenges

  • Functional Annotation: No direct evidence of fslF's role in signaling or differentiation in D. discoideum is available in the literature .

  • Commercial Availability: Some recombinant variants are listed as "not available for sale," indicating restricted access .

Future Research Directions

  1. Functional Characterization: Knockout/knockdown studies in D. discoideum to elucidate fslF’s role in development.

  2. Structural Biology: Cryo-EM or X-ray crystallography to resolve domain arrangements.

  3. Comparative Genomics: Phylogenetic analysis to map fslF’s evolutionary relationships with metazoan Frizzled/Smoothened proteins.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fslF; DDB_0231315; Frizzled and smoothened-like protein F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-591
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslF
Target Protein Sequence
FEIPKGFGIGLVIPDAECLNYIGDPIDQQLCNSKLQNNGDRIYTTTNSQIDSQTNIKKSF EAITFLQDQCKDLLFAQFGICDIYLAPCIEVTLTPLKSISLPQRFCKSVCDRMVSNCPRL EEQMDCSNSFLFPEIGTFYDLSPYGYTIDNGTFAVPCSDPTIFFNQVSSNSSFIEICPSP LLLKNSSDPEYAANKGYSYLSPSNCVLPCPVPNYSNQKWDQLLTMSKILSTISFILSLYN VLTFGIINKKVSDPHKCTCFFSGSIALVNLCDIITYGIGYEELLCPEPGRSAKQQLDPVC GLTGAFFHLGITYCVLWSMTMGLVLYCSVKRQKWFKFNYFLIGNTTFTITTVVIAAATSK FEAGLGSIECWIRDRWYAISLFWIPCGIALLIGSFCIIAVIHEVYKTSKKSISNRNDLLQ RELKPLLIVIFISGSFLYLFIFFFDIERKFGGYRSAVEDYVLCLLNGSQEECFTTGPSYV PYFLFYLVIRWFGIIFFLFYGTSNIARKIWVQNKIWKSISSSISPKSTPKSSPKNSDSKI NSNSTNNNNMILNDNNDKNLNEKKAVELESIKIN
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum fslF protein and why is it significant in research?

Frizzled and Smoothened-like protein F (fslF) is a transmembrane protein expressed in the social amoeba Dictyostelium discoideum. This protein belongs to the G protein-coupled receptor (GPCR) superfamily and shares structural similarities with both Frizzled and Smoothened receptors found in higher eukaryotes. Despite D. discoideum lacking a central nervous system, this organism has proven valuable for studying cellular processes relevant to neurological disorders due to its highly conserved cellular pathways . The fslF protein specifically has significance in understanding the evolution of signaling cascades related to development and cellular communication. Recombinant expression systems have enabled researchers to produce and study this protein in isolation, facilitating both structural and functional analyses that would be challenging in the native cellular environment.

What are the molecular characteristics of recombinant fslF protein?

The recombinant full-length Dictyostelium discoideum fslF protein (catalog number RFL3678DF) consists of amino acids 18-591 of the mature protein, with a molecular weight of approximately 65 kDa. The protein features an N-terminal His-tag to facilitate purification . The amino acid sequence reveals characteristic domains found in Frizzled family proteins, including a cysteine-rich domain (CRD) in the N-terminal region that typically mediates ligand binding and seven transmembrane domains typical of GPCRs. The sequence specifically includes key conserved motifs: FEIPKGFGIGLVIPDA (residues 18-33) at the N-terminus and multiple cysteine residues that likely form disulfide bonds critical for structural integrity . When expressed recombinantly in E. coli, the protein retains these structural features, though proper folding of transmembrane domains presents technical challenges addressed through specialized purification protocols.

How should recombinant fslF be stored to maintain stability and activity?

Optimal storage of recombinant fslF protein requires careful consideration of temperature, buffer conditions, and handling procedures. The lyophilized powder form of recombinant fslF should be stored at -20°C or -80°C upon receipt . For reconstituted protein, storage recommendations include:

  • Initial reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 5-50% (optimal concentration: 50%)

  • Aliquoting into single-use volumes to avoid repeated freeze-thaw cycles

  • Storage of working aliquots at 4°C for up to one week

  • Long-term storage at -20°C or -80°C

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and aggregation . For experiments requiring intact membrane proteins, stabilizing agents such as detergents or lipid nanodiscs may be necessary to maintain the native conformation of the transmembrane domains.

What expression systems are most effective for producing functional recombinant fslF?

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, cost-effective, rapid expressionChallenge with membrane protein folding, lacks eukaryotic post-translational modificationsStructural studies, antibody production, protein interaction assays
Insect cellsBetter membrane protein folding, some post-translational modificationsMore expensive, longer timelineFunctional studies requiring proper folding
Mammalian cellsMost complete post-translational modifications, native-like membrane environmentHighest cost, most complex, lowest yieldStudies requiring authentic signaling dynamics
Cell-free systemsRapid production, ability to incorporate modified amino acidsLower yield, higher costProtein engineering, directed evolution

For recombinant fslF expression in E. coli, optimization of induction conditions (temperature, inducer concentration, duration) is critical to balance between yield and proper folding. Addition of molecular chaperones or fusion partners (e.g., MBP, SUMO) may improve solubility of the membrane protein domains.

What purification strategies yield the highest purity recombinant fslF?

Purification of His-tagged recombinant fslF typically employs immobilized metal affinity chromatography (IMAC) as the primary capture step. A comprehensive purification strategy should include:

  • Cell lysis using appropriate detergents to solubilize membrane-associated protein domains

  • IMAC purification using Ni-NTA or Co-based resins with optimized imidazole concentration gradient

  • Secondary purification steps such as ion exchange chromatography or size exclusion chromatography

  • Quality assessment via SDS-PAGE (achieving >90% purity)

For transmembrane proteins like fslF, incorporation of specific detergents (e.g., DDM, LMNG, or CHAPS) throughout the purification process is essential to maintain protein solubility and native conformation. The final purified product is typically formulated in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which enhances stability during lyophilization and subsequent storage .

How does the His-tag affect the structural and functional properties of recombinant fslF?

The N-terminal His-tag incorporated into recombinant fslF serves primarily as a purification handle but may influence protein characteristics in several ways:

For applications requiring native-like protein, researchers should consider tag removal using specific proteases (e.g., TEV, PreScission) followed by reverse IMAC. Alternatively, C-terminal tagging strategies may be explored if N-terminal structure is critical for function. Comparative functional assays between tagged and untagged versions can help determine the tag's influence on specific experimental applications.

What techniques are most effective for studying fslF interactions with potential binding partners?

Several complementary approaches can be employed to investigate fslF interactions:

  • Co-immunoprecipitation (Co-IP): Using anti-His antibodies to pull down recombinant fslF along with binding partners from cellular lysates

  • Surface Plasmon Resonance (SPR): Quantitative measurement of binding kinetics between immobilized fslF and potential ligands

  • Proximity Labeling: Techniques such as BioID or APEX can identify proteins in close proximity to fslF in cellular environments

  • Yeast Two-Hybrid Screening: Modified for membrane proteins using split-ubiquitin systems

  • Crosslinking Mass Spectrometry: Identification of interaction interfaces through covalent crosslinking followed by proteolytic digestion and MS analysis

For membrane proteins like fslF, developing a reconstituted system using nanodiscs or liposomes can provide a more native-like environment for interaction studies compared to detergent-solubilized protein. The availability of recombinant antibodies against D. discoideum antigens enhances the toolkit for such interaction studies .

How can recombinant fslF be used in the study of signaling pathways in Dictyostelium discoideum?

Recombinant fslF enables multiple approaches to investigate signaling pathways:

  • Ligand Identification: Using purified recombinant fslF in binding assays to screen potential ligands

  • Signaling Reconstitution: Incorporating purified fslF into artificial membrane systems with downstream signaling components

  • Structure-Function Analysis: Engineering mutations in recombinant fslF to identify critical residues for signaling

  • Competitive Inhibition Studies: Using recombinant fslF fragments to disrupt endogenous signaling

  • Antibody-Mediated Pathway Modulation: Developing function-blocking antibodies against specific fslF domains

These approaches complement genetic studies in D. discoideum, where the social amoeba's haploid genome facilitates gene knockout and replacement strategies. The recombinant protein can serve as a valuable control in validating antibody specificity and for developing quantitative assays of pathway activity.

Can fslF research in D. discoideum inform studies of neurological disorders?

Despite lacking neurons, D. discoideum has proven valuable for studying cellular processes relevant to neurological disorders due to its conserved cellular pathways . The fslF protein, as a member of the Frizzled/Smoothened family, may inform research on Wnt signaling pathways implicated in neurodegenerative conditions through several approaches:

  • Using D. discoideum as a simplified model to study basic receptor trafficking mechanisms

  • Investigating potential interactions between fslF and presenilin proteins, which are conserved between D. discoideum and humans and are implicated in Alzheimer's disease

  • Exploring the role of fslF in macropinocytosis and autophagy, processes affected in neurodegenerative disorders

  • Establishing compound screening platforms using fslF-expressing D. discoideum to identify modulators of related signaling pathways

D. discoideum presenilin proteins share functional homology with human presenilin proteins, with the latter capable of rescuing developmental phenotypes in D. discoideum presenilin mutants . Similar functional conservation may exist between fslF and mammalian Frizzled proteins, providing opportunities for comparative studies.

What are the key considerations for developing antibodies against recombinant fslF?

Developing specific antibodies against fslF requires careful epitope selection and validation strategies:

  • Epitope Selection: Analyze the sequence for hydrophilic, surface-exposed regions, avoiding transmembrane domains

  • Antibody Format: Consider both conventional and recombinant antibody approaches

    • Recombinant antibodies offer advantages of reproducibility and defined sequence

    • Phage display techniques have proven successful for D. discoideum antigens

  • Validation Strategy:

    • Western blot against recombinant fslF and native protein from D. discoideum lysates

    • Immunofluorescence microscopy with appropriate controls (knockout strains)

    • Functional assays to determine if antibodies modulate fslF activity

The development of recombinant antibodies has been specifically addressed for D. discoideum proteins, with techniques including hybridoma sequencing and phage display being particularly effective . These approaches ensure reliable reagents accessible to the research community despite the relatively small size of the D. discoideum research field.

How can structural studies of fslF inform evolutionary understanding of Wnt signaling?

Structural analysis of recombinant fslF can provide insights into the evolution of Wnt signaling receptors:

  • Comparative Structural Analysis: Alignment of fslF structure with mammalian Frizzled and Smoothened proteins

  • Domain Conservation Assessment: Identification of conserved structural elements across evolutionary distance

  • Ligand Binding Pocket Analysis: Characterization of potential binding sites through computational docking and mutagenesis

  • Phylogenetic Structural Mapping: Mapping of structural features onto phylogenetic trees to identify evolutionary transitions

These approaches can reveal whether fslF represents a common ancestral form of the separate Frizzled and Smoothened receptors found in higher eukaryotes, or whether it evolved independently. The presence of both Frizzled and Smoothened-like features in a single protein makes fslF particularly interesting for understanding receptor evolution.

What methodological approaches can address the challenges of membrane protein crystallization for fslF?

Crystallization of membrane proteins like fslF presents significant challenges that can be addressed through several strategies:

  • Detergent Screening: Systematic testing of various detergents for their ability to maintain fslF stability while allowing crystal contacts

  • Lipidic Cubic Phase (LCP) Crystallization: Embedding fslF in a lipidic mesophase to mimic the native membrane environment

  • Protein Engineering:

    • Creating fusion constructs with crystallization chaperones (e.g., T4 lysozyme)

    • Truncating flexible regions while preserving core structure

    • Surface entropy reduction through mutation of flexible, charged residues

  • Alternative Structural Methods:

    • Cryo-electron microscopy for detergent-solubilized or nanodisc-reconstituted fslF

    • NMR studies of individual domains

Successful crystallization typically requires highly pure, homogeneous protein preparations (>95% purity) and extensive condition screening. The trehalose present in storage buffer should be removed through dialysis or size exclusion chromatography before crystallization trials.

How can protein aggregation issues with recombinant fslF be resolved?

Membrane proteins like fslF are prone to aggregation during expression and purification. Several strategies can mitigate this issue:

  • Expression Optimization:

    • Reduce expression temperature (16-20°C)

    • Use weaker promoters or lower inducer concentrations

    • Co-express with molecular chaperones

  • Solubilization Improvements:

    • Screen different detergents (mild non-ionic detergents often perform better)

    • Optimize detergent concentration and buffer conditions

    • Consider addition of lipids or cholesterol hemisuccinate

  • Purification Modifications:

    • Include glycerol (5-10%) in all buffers

    • Maintain minimum critical micelle concentration of detergent

    • Use size exclusion chromatography to remove aggregates

    • Consider on-column refolding approaches

  • Storage and Handling:

    • Avoid concentrating above critical thresholds

    • Prevent freeze-thaw cycles by maintaining at 4°C for short-term use

    • Add stabilizing agents such as trehalose (6% as used in commercial preparations)

Monitoring protein aggregation through techniques like dynamic light scattering or analytical ultracentrifugation can provide quantitative feedback on optimization efforts.

What controls are essential when using recombinant fslF in functional studies?

Rigorous experimental design requires several controls when working with recombinant fslF:

  • Protein Quality Controls:

    • SDS-PAGE analysis confirming size and purity

    • Western blot verification with anti-His antibodies

    • Size exclusion chromatography profile demonstrating monodispersity

  • Functional Verification Controls:

    • Heat-denatured fslF as negative control

    • Concentration-dependent response curves

    • Competition assays with known ligands or antibodies

  • Experimental System Controls:

    • Empty vector or irrelevant protein preparations processed identically

    • Untransfected or wild-type D. discoideum extracts

    • For genetic studies, rescue experiments with wild-type fslF

  • Antibody Specificity Controls:

    • Pre-immune serum controls

    • Absorption controls with recombinant antigen

    • Testing in fslF-knockout D. discoideum strains

These controls ensure that observed effects are specifically attributable to fslF rather than contaminants, preparation artifacts, or non-specific interactions.

How can reconstitution of fslF into membrane mimetics improve functional studies?

The transmembrane nature of fslF means its function is intimately linked to the membrane environment. Several reconstitution approaches can enhance functional studies:

  • Nanodiscs: Embedding fslF in nanodiscs composed of membrane scaffold proteins and phospholipids provides a defined, native-like bilayer environment while maintaining water solubility

  • Proteoliposomes: Incorporating fslF into liposomes allows study of both extracellular and intracellular domains and can be adapted for functional assays like ligand binding

  • Bicelles: These disk-shaped bilayer structures provide an intermediate between micelles and liposomes and are particularly suitable for NMR studies

  • Amphipols: These amphipathic polymers can stabilize membrane proteins in solution without conventional detergents

Each approach has specific protocols for reconstitution, typically involving detergent removal through dialysis, adsorption to hydrophobic beads, or dilution below critical micelle concentration. The choice of lipid composition can significantly impact protein stability and activity, with mixtures mimicking the native D. discoideum membrane environment often providing optimal results.

What emerging technologies might advance recombinant fslF research?

Several cutting-edge approaches show promise for advancing fslF research:

  • Cryo-EM advances: Ongoing improvements in resolution and sample preparation for membrane proteins may enable structural determination without crystallization

  • Single-molecule techniques: FRET-based approaches for studying conformational changes during signaling

  • Cell-free expression systems: Specialized membrane protein expression systems incorporating nanodiscs or liposomes during translation

  • Directed evolution approaches: Development of fslF variants with enhanced stability or altered specificity

  • Advanced genetic models: CRISPR-engineered D. discoideum strains expressing modified fslF proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.