Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein G (fslG)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant fslG is manufactured using E. coli expression systems, enabling cost-effective, high-yield production . Protocols include:

  • Expression: Cloning into E. coli vectors with optimized codon usage for eukaryotic proteins .

  • Purification: Affinity chromatography (e.g., His-tag purification) .

  • Storage: Lyophilized powder stable for 12 months at -20°C/-80°C; liquid forms stable for 6 months under the same conditions .

  • Reconstitution: Requires sterile water or PBS with glycerol (5–50%) to prevent aggregation .

3.1. Tool for Eukaryotic Signaling Studies

fslG is used to investigate conserved signaling pathways in Dictyostelium, a model organism for studying chemotaxis, phagocytosis, and developmental biology . Its structural similarity to mammalian Frizzled receptors makes it relevant for Wnt pathway analysis .

3.2. Antibody Development

Recombinant fslG has been utilized to generate monoclonal antibodies for labeling subcellular compartments in Dictyostelium, enhancing studies of protein localization and function .

3.3. Industrial Protein Production

Dictyostelium’s eukaryotic machinery offers advantages over bacterial systems for producing complex proteins, though E. coli remains the primary host for fslG due to scalability .

Challenges and Considerations

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .

  • Species-Specificity: Antibodies against fslG may require validation for cross-reactivity in non-Dictyostelium systems .

  • Post-Translational Limitations: E. coli-produced fslG lacks native glycosylation, necessitating alternative systems (e.g., baculovirus) for modified forms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fslG; DDB_G0288261; Frizzled and smoothened-like protein G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-574
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslG
Target Protein Sequence
LPNGYGVGLVDPNGQCMNYIGDSIDQPLCKNKLSNNGEFIYSTIGNSLNSQTLSQQTIAK SFEALTFIQNQCQDLLFAEYGICNIYLSPCIITTVAPLKNISLPQRLCNSACQRMVTNCP RLGEKIDCSISFLFPEVGTLYNLSDYGYKANGGLYEVPCFNPTADYDNSSSLNEFIEICP SPLLLKNSSDPKYSKRGYTYLPPTNCVLPCPVPNYTKEKWNQIENLSKVLSTISFVCSIY NILSFGILKKKKTKYTICISALSASVALINLGDIIKIGVGYEKVLCPEPGRFATQVDDPL CGLTAALFHVGICSTVLWTTTMAIYLYSAIKNIKLFKFRYFIIFNTGFSLTSLIIAASAS KFEAGTGSIECWIRDRWYSICLFWLPCGICLLIGTICIASVIVEIYKVSKNIKLSESETI MRQIKPIISVILVSGSFTYLFIIFFDIERNFGGYRSAVTDYVLCLLNSTDNGIECHTSGP SYNPYFMFYFFMRFFGILFFLIYGTSKNARDSWYELFIKIKVSLSETSSTISNNSGGGSS QQKQQQQNEIKLEKI
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is fslG and what is its role in Dictyostelium biology?

Frizzled and smoothened-like protein G (fslG) in Dictyostelium discoideum represents a member of the G protein-coupled receptor superfamily with structural similarities to the frizzled/smoothened receptors found in higher organisms. While specific fslG function requires further characterization, it likely participates in signal transduction pathways involved in development and differentiation.

The significance of studying fslG stems from Dictyostelium's established position as a model organism for almost a century, with its fully sequenced, low-redundancy genome providing a simplified system that maintains many conserved signaling pathways found in complex eukaryotes . As a haploid organism, gene function studies including those for fslG can be conducted through relatively straightforward gene disruption techniques . The organism's short 24-hour developmental cycle enables rapid detection of phenotypes resulting from genetic manipulations .

How can I detect and measure fslG expression during the Dictyostelium life cycle?

Detecting fslG expression across Dictyostelium's developmental stages requires stage-specific sampling and appropriate detection methods:

Methodological approach:

  • RT-qPCR: Extract RNA from cells at different developmental timepoints (0h, 4h, 8h, 12h, 16h, 20h, 24h post-starvation) to quantify fslG transcript levels.

  • Western blotting: Generate antibodies against fslG or use epitope-tagged constructs to monitor protein expression throughout development.

  • Live imaging: Create fslG-GFP fusion constructs under native promoter control to visualize expression patterns in real-time.

Based on known expression patterns of developmental genes in Dictyostelium, fslG expression might vary significantly during the transition from unicellular growth to multicellular development. Notably, Dictyostelium developmental gene expression can be affected by nutritional status during growth, as cells grown without glucose (G-) show different developmental fates compared to glucose-fed (G+) cells, often becoming more sensitive to differentiation factors .

What methods can I use to produce recombinant fslG for biochemical studies?

Producing recombinant fslG requires careful consideration of expression systems and purification strategies:

Expression systems comparison:

Expression SystemAdvantagesLimitationsApplications
DictyosteliumNative post-translational modifications; proper foldingLower yieldFunctional studies
E. coliHigh yield; economicalPotential folding issues with membrane proteinsStructural studies (with refolding)
Baculovirus/InsectEukaryotic processing; suitable for membrane proteinsHigher costBiochemical assays

Recommended approach:

  • Clone the fslG gene into an appropriate Dictyostelium expression vector with an affinity tag (His, FLAG, etc.)

  • Transform Dictyostelium cells using electroporation

  • Select transformants using appropriate markers

  • Verify expression using Western blotting

  • Optimize cell lysis and membrane protein extraction using detergents like DDM or CHAPS

  • Purify using affinity chromatography followed by size exclusion chromatography

The availability of various expression constructs for Dictyostelium enables effective protein localization and functional studies, making it a suitable system for producing fslG in its native environment .

How can I generate and characterize fslG knockout mutants in Dictyostelium?

Generating fslG knockout mutants leverages Dictyostelium's haploid genome and well-established genetic tools:

Step-by-step knockout protocol:

  • Design targeting construct with homology arms flanking fslG and selection marker (e.g., blasticidin resistance)

  • Transform Dictyostelium cells by electroporation

  • Select transformants with appropriate antibiotic

  • Verify knockout by PCR, Southern blotting, and RT-PCR

  • Confirm absence of protein expression by Western blotting

Phenotypic characterization approaches:

  • Growth assessment: Compare doubling times in axenic culture and on bacterial lawns

  • Developmental timing analysis: Monitor progression through developmental stages using time-lapse imaging

  • Cell-type proportioning: Examine pstO and pstB cell fates using appropriate markers, as these are DIF-dependent lineages frequently affected in signaling mutants

  • Chimeric development: Mix knockout and wild-type cells to assess cell autonomy and competitive fitness in development

The phenotypic analysis should focus on developmental processes where fslG likely functions, particularly cell differentiation and pattern formation. The mutant's response to different growth conditions (e.g., with/without glucose) should be examined since nutritional status affects cell fate decisions in Dictyostelium .

What imaging techniques are most effective for studying fslG localization and dynamics?

Imaging fslG requires approaches tailored to membrane protein visualization:

Advanced imaging methodologies:

  • Confocal microscopy with fslG-fluorescent protein fusions to determine subcellular localization

  • Total Internal Reflection Fluorescence (TIRF) microscopy to visualize membrane dynamics with high resolution

  • Förster Resonance Energy Transfer (FRET) to monitor protein-protein interactions, similar to techniques used for studying G-protein dynamics in Dictyostelium

  • Photoactivatable fluorescent protein tags to track protein movement and turnover

Sample preparation considerations:

  • Create C-terminal or N-terminal fluorescent protein fusions, evaluating which retains function

  • Include membrane markers for co-localization studies

  • Use inducible promoters to achieve physiological expression levels

  • For developmental studies, prepare cells at different stages on glass-bottom dishes

For quantitative analysis, establish computational image analysis pipelines to measure parameters such as membrane/cytosol ratio, clustering, and co-localization with known signaling components. This approach parallels established methods for analyzing G-protein dynamics in Dictyostelium, where FRET between subunits has been used to monitor activation states .

How can I identify potential binding partners and signaling pathways associated with fslG?

A multi-faceted approach is necessary to elucidate the fslG interactome and signaling networks:

Protein interaction methodologies:

  • Co-immunoprecipitation using tagged fslG followed by mass spectrometry

  • Proximity labeling (BioID or APEX) to identify nearby proteins in the native cellular environment

  • Yeast two-hybrid screening using cytoplasmic domains of fslG

  • Bimolecular Fluorescence Complementation (BiFC) to validate interactions in vivo

Signaling pathway analysis:

  • Phosphoproteomics comparing wild-type and fslG knockout cells to identify downstream signaling events

  • Epistasis analysis through creation of double mutants with known signaling components

  • Transcriptome analysis to identify genes affected by fslG disruption

Based on knowledge of G-protein signaling in Dictyostelium, fslG likely couples to specific G-protein subunits to transduce signals . The activation of these G-proteins can be monitored through FRET between the alpha- and beta-subunits . This approach could reveal how fslG influences downstream signaling cascades that ultimately affect developmental processes and cell fate decisions.

How does fslG contribute to cell fate decisions during Dictyostelium development?

Based on our understanding of signaling pathways in Dictyostelium development, fslG may influence cell fate decisions through several mechanisms:

Experimental approaches to assess cell fate influence:

  • Analyze cell-type proportioning in fslG mutants using cell-type specific markers

  • Examine sensitivity to DIF (Differentiation Inducing Factor), which is required for prestalk cell differentiation, particularly pstB cells

  • Conduct chimeric development experiments mixing wild-type and fslG mutant cells at different ratios to assess competitive advantages in adopting specific fates

  • Test for nutritional biases by comparing cells grown with/without glucose, as nutritional status affects cell fate decisions

The nutritional conditions during growth significantly impact Dictyostelium cell fate choices. For instance, cells grown without glucose (G-) produce fewer spores than glucose-fed cells (G+) when developed together, because G- cells are biased toward DIF-dependent prestalk lineages . If fslG functions in pathways similar to other signaling proteins like GefE, its disruption might specifically affect DIF-dependent lineage bias .

What role might fslG play in chemotaxis and cell movement during aggregation?

Dictyostelium serves as an excellent model for studying cell movement and chemotaxis. For investigating fslG's potential role:

Methodological approaches:

  • Under-agarose chemotaxis assays to measure directed cell movement toward cAMP

  • Micropipette assays to analyze acute responses to localized chemoattractant sources

  • Time-lapse imaging of aggregation streams to assess cell behavior during natural chemotaxis

  • Computer-assisted tracking of individual cells to quantify speed, directionality, and persistence

Parameters to measure:

  • Cell speed (μm/min)

  • Directionality (cosine of angle between movement and gradient)

  • Actin polymerization dynamics using fluorescent actin markers

  • Phosphoinositide signaling using PH-domain reporters

The analysis should compare wild-type, fslG knockout, and rescue strains. If fslG functions like other membrane receptors in Dictyostelium, it may couple to G-proteins that regulate the cytoskeleton and cell movement. The model for cell movement in Dictyostelium demonstrates how individual cell behavior produces collective motion, which could be affected by fslG disruption .

How can I determine if fslG functions in a cell-autonomous or non-autonomous manner?

Distinguishing between cell-autonomous and non-autonomous functions requires careful experimental design:

Cell autonomy testing protocol:

  • Create chimeric aggregates with different ratios of wild-type and fslG mutant cells

  • Label cells with distinct fluorescent markers (e.g., GFP for wild-type, RFP for mutants)

  • Track cell behavior and fate during development using confocal microscopy

  • Quantify distribution of each cell type in different regions of the aggregate

Analysis metrics:

  • Proportion of each cell type in different regions (prespore vs. prestalk)

  • Ability of wild-type cells to rescue mutant cell behavior in mixed aggregates

  • Changes in gene expression in wild-type cells when mixed with mutant cells

This approach parallels chimeric experiments used to study the role of GefE in Dictyostelium, which revealed that GefE-deficient cells were excluded from DIF-dependent pstB and pstO fates when mixed with wild-type cells . Chimeric development provides key insights into whether a protein functions within the cell that expresses it (cell-autonomous) or affects neighboring cells (non-autonomous).

What structural domains of fslG are essential for its function?

Understanding the structure-function relationship of fslG requires systematic domain analysis:

Domain mapping strategy:

  • Conduct bioinformatic analysis to predict domains based on homology with known frizzled and smoothened proteins

  • Create truncation mutants removing specific domains

  • Generate point mutations in conserved residues

  • Test functionality of each construct by expressing in fslG knockout cells

Expected domains and their functions:

  • N-terminal cysteine-rich domain (CRD): likely involved in ligand binding

  • Seven transmembrane domains: signal transduction

  • Intracellular loops: G-protein coupling

  • C-terminal tail: potential phosphorylation sites and protein interaction motifs

The approach should be guided by the understanding that Dictyostelium has a haploid genome, which simplifies genetic manipulation for structure-function studies . Expression constructs available for Dictyostelium enable detailed analysis of protein domains and their functions .

How can I assess the potential interactions between fslG and G-proteins?

G-protein coupling is likely central to fslG function, given its similarity to G-protein coupled receptors:

G-protein interaction analysis methods:

  • Co-immunoprecipitation of fslG with various G-protein subunits

  • FRET assays between tagged fslG and G-protein subunits

  • GTPγS binding assays to measure G-protein activation in membrane preparations

  • Genetic epistasis tests with G-protein subunit mutants

Experimental design for FRET analysis:

  • Create cells expressing fluorescently tagged G-protein α and β subunits

  • Introduce stimuli that potentially activate fslG

  • Monitor changes in FRET as evidence of G-protein activation or dissociation

Previous work has shown that heterotrimeric G-protein activation can be monitored by changes in FRET between the alpha- and beta-subunits in Dictyostelium . This approach could be adapted to specifically study how fslG influences G-protein dynamics and activation states in response to different stimuli.

What approaches can I use to identify potential ligands for fslG?

Identifying ligands for orphan receptors like fslG requires creative approaches:

Ligand screening methodologies:

  • Candidate approach testing known developmental factors in Dictyostelium

  • Bioassay using reporter systems that monitor G-protein activation or calcium release

  • Binding assays with purified fslG extracellular domain and fractionated Dictyostelium extracts

  • Comparative transcriptomics to identify potential ligand genes co-expressed with fslG

Experimental screening pipeline:

  • Express the extracellular domain of fslG as a fusion protein

  • Purify the fusion protein and immobilize on beads or biosensor chips

  • Screen fractionated conditioned media from developing Dictyostelium

  • Identify binding fractions using mass spectrometry

  • Validate candidate ligands using cellular assays

The identification of ligands would significantly advance our understanding of fslG signaling. If fslG functions like other frizzled-family proteins, it may bind secreted glycoproteins involved in cell-cell communication during development.

How can fslG research in Dictyostelium contribute to understanding human disease mechanisms?

Dictyostelium provides valuable insights into conserved cellular processes relevant to human diseases:

Disease research applications:

  • Neurodegenerative diseases: If fslG participates in pathways similar to human frizzled/smoothened signaling, it could provide insights into diseases where these pathways are dysregulated. Dictyostelium has been established as a model for studying proteins implicated in neurological disorders including Alzheimer's, Parkinson's, and Huntington's diseases .

  • Developmental disorders: Since frizzled/smoothened pathways are critical for embryonic development, understanding fslG function could illuminate fundamental mechanisms disrupted in human developmental disorders.

  • Cancer biology: Wnt/frizzled signaling is frequently dysregulated in various cancers. Studying the basic mechanisms of fslG signaling could reveal conserved aspects relevant to cancer development.

Translational research approach:

  • Identify human homologs of fslG-interacting proteins

  • Express human disease-associated variants in Dictyostelium

  • Screen for compounds that rescue fslG mutant phenotypes

Dictyostelium offers advantages for disease modeling due to its simplified genome with reduced redundancy yet conservation of many signaling pathways found in humans .

How can high-throughput screening approaches be used to identify modulators of fslG function?

Dictyostelium is well-suited for high-throughput screens to identify compounds affecting fslG signaling:

High-throughput screening protocols:

  • Phenotypic screens based on developmental outcomes in fslG mutants

  • Reporter-based screens using transcriptional reporters downstream of fslG

  • Cell-based assays measuring chemotaxis or cell differentiation

  • Genetic modifier screens using insertional mutagenesis in fslG backgrounds

Screen implementation strategy:

  • Establish clear readouts for fslG activity (e.g., reporter gene expression)

  • Optimize assay conditions in 96 or 384-well format

  • Screen compound libraries or mutagenized cell populations

  • Validate hits with secondary assays

  • Identify targets or mechanisms using genomic approaches

Insertional mutant libraries in Dictyostelium facilitate pharmacogenetics screens that have enhanced understanding of bioactive compounds at a cellular level . This approach could identify both genetic and chemical modulators of fslG signaling.

What comparative approaches can reveal the evolutionary significance of fslG in signal transduction?

Evolutionary analysis can provide context for understanding fslG function:

Comparative and evolutionary methodologies:

  • Phylogenetic analysis of fslG-related proteins across species

  • Domain conservation analysis comparing Dictyostelium fslG with homologs from other organisms

  • Functional complementation studies testing if fslG can rescue frizzled/smoothened mutants in other models

  • Heterologous expression of fslG in mammalian cells to test interaction with mammalian signaling components

Evolutionary significance assessment:

  • Identify primitive vs. derived features of frizzled/smoothened signaling

  • Determine if fslG represents an evolutionary precursor to distinct frizzled and smoothened proteins

  • Assess conservation of G-protein coupling mechanisms across species

This approach takes advantage of Dictyostelium's position in evolutionary history, providing insights into the ancestral functions of signaling pathways that have diversified in higher organisms. The fully sequenced, low redundancy genome of Dictyostelium provides a less complex system to work with, while still maintaining many genes and related signaling pathways found in more complex eukaryotes .

How can I overcome difficulties in purifying membrane proteins like fslG for structural studies?

Membrane protein purification presents unique challenges that require specialized approaches:

Optimization strategies:

  • Detergent screening: Test multiple detergents (DDM, LMNG, CHAPS) at various concentrations

  • Lipid addition: Supplement purification buffers with specific lipids to maintain stability

  • Nanodiscs or SMALPs: Transfer purified protein into lipid nanodiscs for a more native environment

  • Thermostability assays: Identify conditions that enhance protein stability

Purification workflow optimization:

  • Use fluorescence size-exclusion chromatography to monitor protein quality

  • Implement on-column detergent exchange strategies

  • Consider fusion partners that enhance expression and solubility

  • Explore insect cell or mammalian expression for complex membrane proteins

The purified protein can be validated using circular dichroism to assess secondary structure integrity and ligand binding assays to confirm functionality. These approaches build on established methods for membrane protein purification while addressing the specific challenges of working with fslG.

What strategies can address potential redundancy if fslG knockout shows subtle phenotypes?

Functional redundancy often masks phenotypes in single gene knockouts:

Redundancy-addressing approaches:

  • Generate multiple gene knockouts targeting related receptors

  • Sensitized background screens combining fslG knockout with subtle disruptions of related pathways

  • Stress conditions that may reveal phenotypes not apparent under optimal growth

  • Quantitative phenotyping using high-resolution imaging and computational analysis to detect subtle defects

Experimental design for subtle phenotype detection:

  • Compare development under various stressors (temperature, pH, osmotic stress)

  • Perform competitive development assays with precise cell mixture ratios

  • Use microfluidic devices for controlled gradient formation and single-cell tracking

  • Apply RNA-seq to identify compensatory gene expression changes

This strategy leverages Dictyostelium's haploid genome, which allows researchers to introduce multiple gene disruptions with relative ease . Even subtle phenotypes can be informative when properly quantified and compared across different genetic backgrounds and environmental conditions.

How can I ensure reproducibility in fslG developmental studies between different laboratories?

Standardization is crucial for reproducible developmental studies:

Reproducibility enhancement protocol:

  • Standardize growth conditions: Define precise media composition, cell density, and growth phase

  • Control developmental initiation: Standardize washing procedures and buffer composition

  • Document environmental parameters: Monitor temperature, humidity, and light conditions

  • Quantitative imaging protocols: Establish standard acquisition settings and analysis pipelines

  • Strain validation: Verify genetic modifications before experiments

Standardization checklist:

  • Cell density at harvest: 2-5 × 10^6 cells/mL in late log phase

  • Growth media batch consistency and quality control

  • Development buffer composition and pH verification

  • Consistent developmental substrate (agar concentration, plate size)

  • Humidity control during development (>95% relative humidity)

  • Defined imaging timepoints and magnifications

The reproducibility of developmental studies is particularly important in Dictyostelium research, as the 24-hour multicellular developmental phase with distinct stages can be affected by subtle variations in experimental conditions . Standardization ensures that phenotypes attributed to fslG manipulation are genuine and not artifacts of varying experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.