Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein J (fslJ-1)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Dictyostelium discoideum Frizzled and Smoothened-like protein J (fslJ-1) is a synthetic version of the endogenous protein encoded by the fslJ-1 gene in the cellular slime mold D. discoideum. This protein belongs to the G-protein-coupled receptor (GPCR) family and plays critical roles in cell signaling, proliferation regulation, and chemorepulsion. It is produced via bacterial recombinant expression systems (e.g., E. coli) and purified for research applications .

Key Properties

PropertyDetail
Gene NamefslJ-1 (synonyms: cnrA, DDB_G0272885)
Uniprot IDQ556J4
Host OrganismDictyostelium discoideum (Slime mold)
TagN-terminal His-tag
Expression RegionFull-length mature protein (aa 27–607)
Storage BufferTris-based buffer with 50% glycerol
Purity>90% (SDS-PAGE)

Biological Function

fslJ-1 is implicated in autocrine signaling and cell density regulation in D. discoideum. Key findings include:

Role in Proliferation and Chemorepulsion

  • Proliferation Inhibition: fslJ-1 interacts with autocrine proliferation repressors like AprA and CfaD. Mutants lacking fslJ-1 (e.g., fslB¯, fslK¯) exhibit reduced maximum cell density and altered colony morphology .

  • Chemorepulsion: fslJ-1 contributes to repelling cells from colony edges, ensuring proper colony formation. Mutants form tightly edged colonies with reduced dispersal .

Genetic and Functional Data

Mutant StrainDoubling Time (h)Max Cell Density (10⁶ cells/ml)Phenotype
WT14.3 ± 0.221.9 ± 1.7Normal proliferation
fslB¯16.7 ± 1.113.6 ± 1.3**Reduced cell density
fslK¯16.1 ± 1.313.7 ± 1.2**Abnormal colony edges

*Data from . P < 0.01 vs. WT.

Cell Signaling Studies

fslJ-1 is used to study GPCR-mediated signaling in D. discoideum. Its role in AprA/CfaD pathways highlights its importance in:

  • Negative Regulation of Proliferation: fslJ-1-deficient cells show insensitivity to AprA-induced growth inhibition .

  • Colony Morphology: Mutants exhibit tightly packed colonies due to impaired chemorepulsion .

Drug Discovery

Dictyostelium species are emerging as sources of novel bioactive compounds. While fslJ-1 itself is not a therapeutic agent, its study informs mechanisms of GPCR signaling, which may inspire drug targets for diseases involving aberrant cell proliferation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fslJ-1; cnrA; DDB_G0272885; fslJ-2; DDB_G0274011; Frizzled and smoothened-like protein J; Cell number regulator protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-607
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslJ-1
Target Protein Sequence
QYFPLDKGATCQKYRGDSPGIQLCDGFLSNPNSIYINSTSSQEAIQAQGNLVRQYINFYK SFESCKNPRTFALLCAFLFPECEKYTDPVSKVTYAYPILPCYNNCLNMTTSCQISTSRLS CATKYTFENISYSVFPKNTTTYQIDSLSYTNTCENTDLIANSQNTSIQQCFEPLVYHVST DEIHDKSIGYIFPSTNTTCVVGCPAPLYYANQWRNIYRLSDVLSILSCILTLFLVITLGI INPKVSRFDKINVMLLSSIFLQAFSGALMTFNGTENTLCPEDGRFASYIDRMCVATGFLL HGSSLLVVQWWCVLSFEVWFTIFQVGKKQKDRFIYYLVASLIIAWIPPIVSISKNEYSGG PANPFCWLTTFNYRRFAFWLPMGIFLCLGGVFLILLMREIYVIVSGNVQSTKESRFKVLK MEAKPIISLIMYFSCLLYLFIYDQWINNHMHVYTDSIPSYALCLLTSTSTNDCLLKAPDI TGLGYFIYSIRVFGVYAFIIYGISKKTLQIWKYNYFVVFIGQKIEQFTNATTTAKSSNSN NSSTTNNISVKASSNMEYETRQENENGDSQSVELDSNSDAL
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is fslJ-1 and why is it important for research?

Frizzled and smoothened-like protein J (fslJ-1) is a protein expressed in Dictyostelium discoideum that belongs to the Frizzled receptor family, which plays crucial roles in cell signaling pathways. The protein is alternatively known as Cell number regulator protein A (cnrA) and is encoded by genes fslJ-1 (DDB_G0272885) and fslJ-2 (DDB_G0274011) . The significance of fslJ-1 in research stems from its potential involvement in developmental regulation and cell-cell communication within the social amoeba D. discoideum, which serves as an excellent model organism for studying fundamental cellular processes. As a member of the Frizzled family, fslJ-1 may participate in signaling cascades analogous to those observed in higher organisms, making it valuable for comparative studies of evolutionary conserved pathways . Understanding this protein's function contributes to broader knowledge of cellular differentiation, morphogenesis, and potentially cell-autonomous defense mechanisms in simple eukaryotic systems.

What are the structural characteristics of fslJ-1 protein?

The recombinant fslJ-1 protein is a full-length mature protein comprising amino acids 27-607 of the native sequence . The protein features a complex structure with multiple functional domains characteristic of the Frizzled receptor family. According to available sequence data, the full amino acid sequence includes regions that are likely involved in ligand binding, signal transduction, and membrane integration . The mature protein contains numerous cysteine residues that are potentially involved in disulfide bond formation, contributing to its tertiary structure and stability. Additionally, the protein contains several conserved motifs that are essential for its function in cellular signaling pathways. The complete amino acid sequence, as documented in search results, includes multiple functional regions that are characteristic of membrane-associated receptors, suggesting its role in transmembrane signaling processes . Understanding these structural elements is crucial for researchers investigating protein-protein interactions and signaling mechanisms involving fslJ-1.

How does fslJ-1 function in Dictyostelium discoideum's life cycle?

While specific details about fslJ-1's role in D. discoideum's life cycle are not comprehensively documented in the provided search results, we can infer its probable functions based on its classification and the general biology of this organism. As a Frizzled-like protein, fslJ-1 likely participates in cell signaling during the complex life cycle of D. discoideum, which transitions from unicellular amoebae to multicellular structures . During the growth phase, individual amoeboid cells feed on bacteria and replicate by binary fission, and upon starvation, they enter a developmental phase involving cell aggregation, mound formation, and eventually culmination in a fruiting body structure . The alternative name "Cell number regulator protein A" suggests that fslJ-1 may be involved in controlling cell proliferation or density sensing during these transitions. The protein potentially functions in intercellular communication necessary for coordinated movement and differentiation during the aggregation and multicellular stages . Given D. discoideum's well-established status as a model organism for studying cell-autonomous defenses, fslJ-1 might also participate in sensing environmental cues or pathogen recognition mechanisms that influence developmental decisions.

What are the most effective expression systems for producing recombinant fslJ-1?

The recombinant production of Dictyostelium discoideum fslJ-1 protein has been successfully achieved using E. coli expression systems, as evidenced by commercially available recombinant products . When establishing an expression system for fslJ-1, researchers should consider optimizing codon usage for the host organism, as the original D. discoideum sequence may contain codons that are rare in E. coli. The expression construct should include appropriate fusion tags, such as polyhistidine (His) tags, which facilitate downstream purification processes and potentially enhance protein solubility . Temperature, induction conditions, and duration of expression all require optimization to maximize yield while minimizing the formation of inclusion bodies. Drawing from methodologies used for other recombinant proteins, such as those described for Japanese eel gonadotropins, researchers might also consider using mammalian expression systems like FreeStyle 293-F cells for producing proteins requiring complex folding or post-translational modifications . When expressing membrane-associated proteins like fslJ-1, the addition of solubilizing agents or expression as truncated soluble domains may improve yield and functionality. The choice between prokaryotic and eukaryotic expression systems should be guided by the intended application and the requirement for native-like structure and function.

What purification strategies yield the highest purity and bioactivity of recombinant fslJ-1?

Purification of recombinant fslJ-1 typically employs affinity chromatography utilizing the engineered fusion tags, with His-tagged recombinant versions being commonly reported . A multi-step purification process beginning with affinity chromatography using nickel or cobalt resins to capture the His-tagged protein provides the foundation for obtaining highly pure preparations. Following initial capture, size exclusion chromatography can separate correctly folded monomeric protein from aggregates and degradation products, while ion exchange chromatography may further enhance purity by exploiting charge differences. Throughout the purification process, maintaining protein stability is crucial; this often requires optimization of buffer conditions including pH, ionic strength, and the addition of stabilizing agents such as glycerol, which is used in the storage buffer for commercial preparations (50% glycerol in Tris-based buffer) . For maintaining bioactivity, purification steps should be performed at low temperatures (4°C) when possible, and protease inhibitors should be included to prevent degradation. The purified protein's activity should be assessed using functional assays relevant to its predicted biological role, such as ligand binding assays or cell-based signaling assays. Storage conditions, including concentration, buffer composition, and temperature (-20°C to -80°C for extended storage), significantly impact long-term stability and activity retention .

How can researchers overcome solubility and stability challenges with recombinant fslJ-1?

Recombinant fslJ-1 protein, being a potential membrane-associated receptor, presents inherent challenges regarding solubility and stability during expression and purification processes. To address these challenges, researchers can employ several strategies beginning with expression construct design, such as using solubility-enhancing fusion partners like thioredoxin, glutathione S-transferase (GST), or maltose-binding protein (MBP) in addition to affinity tags . Expression conditions can be modified by reducing temperature (16-20°C) during induction to slow protein synthesis and allow proper folding, or by using specialized E. coli strains engineered to enhance disulfide bond formation and proper folding of complex proteins. During purification, the inclusion of mild detergents or lipid nanodiscs can help maintain the native conformation of membrane-associated domains. Buffer optimization is critical; additives such as glycerol (used at 50% in commercial preparations), low concentrations of reducing agents, and specific ions can significantly enhance stability . For long-term storage, flash-freezing aliquots and storing at -80°C prevents repeated freeze-thaw cycles that can lead to protein degradation or aggregation. Additionally, researchers should avoid repeated freezing and thawing, as indicated in the handling recommendations for commercial preparations . Protein engineering approaches, such as removing hydrophobic regions or creating truncated versions containing only specific domains of interest, may also improve solubility while preserving the functional regions required for specific research applications.

What experimental approaches are most effective for studying fslJ-1 interactions with other proteins?

Investigating the protein interaction partners of fslJ-1 requires a multi-faceted approach combining both in vitro and cellular techniques. Co-immunoprecipitation (Co-IP) represents a foundational method where antibodies against fslJ-1 or its fusion tag can pull down protein complexes from cell lysates, followed by mass spectrometry identification of binding partners . Pull-down assays using purified recombinant fslJ-1 as bait can identify direct interactors under controlled conditions, while yeast two-hybrid screening provides an alternative approach for detecting binary protein interactions in a cellular context . Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) offer quantitative measurements of binding kinetics and thermodynamics for characterized interactions. For cellular validation, techniques like Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can confirm interactions in living cells. Taking advantage of D. discoideum's genetic tractability, researchers can generate knockout or knockdown strains to assess the physiological relevance of identified interactions . Proximity-dependent biotin identification (BioID) or proximity ligation assays (PLA) represent newer approaches that can capture transient or weak interactions in their native cellular environment. When designing these experiments, researchers should consider both positive and negative controls and validate key findings through multiple independent methods to ensure robustness of the results.

How can fslJ-1 be used in the study of Dictyostelium discoideum development and signaling pathways?

The fslJ-1 protein, as a Frizzled and smoothened-like protein, likely plays a significant role in D. discoideum's development and signaling networks, making it a valuable tool for studying these processes. Researchers can generate fluorescently tagged fslJ-1 constructs to visualize its spatial and temporal expression patterns throughout the organism's developmental cycle, from the unicellular amoeboid stage through aggregation, mound formation, and culmination in the fruiting body . CRISPR-Cas9 gene editing can create knockout or knock-in mutants to assess the phenotypic consequences of fslJ-1 absence or modification, potentially revealing its role in morphogenesis, cell differentiation, or cell migration during development. Transcriptomic analysis across developmental time points can identify genes co-regulated with fslJ-1, suggesting functional relationships and pathway involvement. For signaling studies, researchers can utilize the recombinant protein in reconstitution experiments to determine if it activates specific downstream pathways, similar to approaches used with other recombinant signaling proteins . Phosphoproteomics following fslJ-1 stimulation or deletion can map the signal transduction networks influenced by this protein. Structure-function analysis through domain deletion or mutation can identify regions critical for specific aspects of signaling or development. D. discoideum's amenability to microscopy, including live-cell imaging, makes it possible to directly observe the effects of fslJ-1 manipulation on cellular behaviors during development .

What are the implications of fslJ-1 research for understanding evolutionary conserved signaling mechanisms?

Research on fslJ-1 in Dictyostelium discoideum provides valuable insights into evolutionarily conserved signaling mechanisms across eukaryotes. As a member of the Frizzled receptor family, fslJ-1 likely participates in pathways analogous to Wnt signaling in higher organisms, allowing researchers to study the evolution of these critical developmental pathways in a simpler model system . The alternative designation of fslJ-1 as Cell number regulator protein A (cnrA) suggests involvement in growth control mechanisms, which could reveal fundamental principles of cell proliferation regulation conserved from single-celled organisms to complex multicellular life . Comparative analyses of fslJ-1 structure, function, and interacting partners with Frizzled receptors from other organisms can illuminate both conserved core functions and lineage-specific adaptations in signaling networks. D. discoideum's position as a social amoeba that exhibits both unicellular and multicellular life stages makes it particularly valuable for understanding the evolutionary transitions to multicellularity and the signaling mechanisms that enable coordinated cellular behaviors . The organism's experimental tractability, including its haploid genome, established genetic tools, and amenability to imaging techniques, facilitates detailed mechanistic studies that might be more challenging in complex organisms . Insights gained from fslJ-1 research might ultimately inform our understanding of related signaling pathways in human health and disease, particularly in areas like developmental disorders, cancer biology, and regenerative medicine where Wnt/Frizzled signaling plays crucial roles.

How can structural biology approaches enhance our understanding of fslJ-1 function?

Advanced structural biology techniques offer powerful approaches to elucidate the molecular mechanisms underlying fslJ-1 function in Dictyostelium discoideum. X-ray crystallography of purified recombinant fslJ-1, particularly of specific functional domains, can provide atomic-resolution insights into the protein's structure, revealing ligand-binding pockets, interaction surfaces, and conformational states that dictate its signaling properties . Cryo-electron microscopy (cryo-EM) represents an alternative approach that may be particularly valuable for examining fslJ-1 in complex with binding partners or within membrane environments, potentially capturing different functional states of the receptor. Nuclear magnetic resonance (NMR) spectroscopy, while typically limited to smaller protein domains, can provide dynamic information about protein regions that undergo conformational changes during signaling processes. Molecular dynamics simulations, informed by experimental structural data, can model how fslJ-1 behaves in membrane environments and how it responds to ligand binding or protein-protein interactions. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers insights into protein dynamics and conformational changes in solution, complementing static structural approaches. Structure-guided mutagenesis experiments, where specific amino acids identified through structural studies are modified, can validate functional predictions and determine structure-function relationships. The complete amino acid sequence of fslJ-1 provided in the research materials can serve as the foundation for these structural biology investigations, allowing targeted studies of key regions within the 27-607 expression region of the mature protein .

What cutting-edge genetic manipulation techniques can be applied to study fslJ-1 in vivo?

The genetic tractability of Dictyostelium discoideum makes it an excellent model for applying state-of-the-art genetic manipulation techniques to study fslJ-1 function in vivo. CRISPR-Cas9 genome editing can create precise modifications including gene knockouts, knock-ins, or specific point mutations in the fslJ-1 gene (DDB_G0272885) or its paralog fslJ-2 (DDB_G0274011) to assess their functional consequences . Inducible expression systems allow temporal control over fslJ-1 expression, enabling researchers to determine stage-specific requirements during D. discoideum's complex life cycle from unicellular growth to multicellular development . Optogenetic or chemogenetic approaches can provide spatiotemporal control over fslJ-1 activity, allowing researchers to activate or inhibit the protein in specific cells or at defined developmental stages. Fluorescent protein tagging through endogenous locus modification can visualize fslJ-1 localization and dynamics in living cells without disrupting its native regulation. Single-cell RNA sequencing of wild-type versus fslJ-1 mutant cells during development can reveal global transcriptional consequences of fslJ-1 disruption and identify downstream regulatory networks. CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) systems can modulate fslJ-1 expression levels without permanently altering the genome, providing flexibility in experimental design. Leveraging D. discoideum's established molecular genetic toolkit and the community resources available through databases like dictyBase enhances the feasibility and impact of these genetic approaches for unraveling fslJ-1 function in developmental and cellular processes .

How can computational approaches predict fslJ-1 functional networks and evolutionary relationships?

Computational biology offers powerful tools for predicting and analyzing fslJ-1 functional networks and evolutionary relationships without requiring extensive wet-lab experimentation. Homology modeling using the known amino acid sequence can predict the three-dimensional structure of fslJ-1 based on structurally characterized Frizzled and smoothened receptors from other organisms, generating testable hypotheses about functional domains and ligand-binding regions . Phylogenetic analysis comparing fslJ-1 sequences across species can reconstruct evolutionary history, identify conserved functional motifs, and reveal lineage-specific adaptations in the Frizzled receptor family. Protein-protein interaction prediction algorithms can identify potential binding partners based on sequence features, structural characteristics, and co-expression patterns, guiding subsequent experimental validation . Network analysis integrating available -omics data can place fslJ-1 within broader signaling networks and cellular pathways in D. discoideum, potentially revealing unexpected functional connections. Molecular docking simulations can predict potential ligands or small molecule modulators of fslJ-1 activity, informing drug discovery approaches or tool compound development. Transcriptomic data mining across D. discoideum developmental stages can identify genes showing coordinated expression with fslJ-1, suggesting functional relationships. Text mining of scientific literature using natural language processing can extract implicit relationships between fslJ-1 and other proteins or biological processes from published research. These computational approaches are particularly valuable for generating hypotheses about fslJ-1 function in contexts where experimental data is limited, and can guide targeted laboratory investigations to maximize research efficiency.

What are the major technical challenges in studying fslJ-1 and how can they be overcome?

Researchers investigating fslJ-1 face several significant technical challenges that require innovative solutions. One primary difficulty is the potential membrane association of this Frizzled-like protein, which can complicate expression, purification, and structural studies due to hydrophobicity and requirements for lipid environments . This challenge can be addressed by using specialized expression systems designed for membrane proteins, incorporating nanodiscs or liposomes during purification, or focusing on soluble domains for initial characterization. The current lack of comprehensive functional annotation for fslJ-1 presents another obstacle; researchers can overcome this through comparative studies with better-characterized Frizzled receptors, systematic mutagenesis coupled with phenotypic assays, or unbiased screening approaches to identify interacting partners and affected pathways . Generating specific antibodies against fslJ-1 may be difficult due to potential conservation with related proteins; epitope selection guided by sequence analysis, recombinant fragment immunization strategies, or tagged protein approaches can mitigate this issue. The complexity of D. discoideum's life cycle introduces temporal variables that complicate experimental design and interpretation; this can be managed through carefully timed sampling, stage-specific isolation techniques, or the development of synchronization protocols . Determining physiologically relevant ligands for fslJ-1 represents another significant challenge; candidate approaches based on known Frizzled interactions, unbiased screens using the purified protein, or genetic suppressor screens may identify binding partners. Finally, distinguishing the functions of fslJ-1 from its paralog fslJ-2 requires careful genetic approaches such as creating single and double mutants, paralog-specific tagging, or rescue experiments with chimeric proteins .

How might fslJ-1 research contribute to broader understanding of cellular signaling evolution?

Research on fslJ-1 in Dictyostelium discoideum provides a unique window into the evolutionary history of cellular signaling systems across eukaryotes. As D. discoideum occupies a fascinating phylogenetic position—diverging after plants but before the animal-fungal split—studies of its signaling proteins can illuminate both ancient conserved mechanisms and lineage-specific innovations in cellular communication . The presence of Frizzled-like proteins in this social amoeba suggests that certain aspects of these signaling systems predate the evolution of animals, potentially representing core eukaryotic signaling modules that were later elaborated in complex multicellular organisms. Comparative genomic analyses of fslJ-1 with Frizzled receptors across diverse taxa can reconstruct the evolutionary trajectory of these signaling components, identifying conserved functional domains and regulatory features that have withstood hundreds of millions of years of evolution. D. discoideum's transition between unicellular and multicellular stages makes it particularly valuable for understanding how signaling networks might have been co-opted or modified during the evolution of multicellularity, with fslJ-1 potentially playing important roles in this transition . Functional studies comparing the signaling mechanisms of fslJ-1 with those of Frizzled receptors in animals could reveal fundamental principles of receptor evolution, including how ligand specificity, downstream pathway activation, and regulatory mechanisms diversify over evolutionary time. Additionally, understanding the role of fslJ-1 in D. discoideum's rudimentary immune system, including possible functions in sentinel cells that protect the organism from infection, might provide insights into the ancient origins of cell-autonomous defense mechanisms that later evolved into sophisticated immune systems in animals .

What interdisciplinary approaches might yield breakthrough insights about fslJ-1 function?

The most promising advances in understanding fslJ-1 function will likely emerge from interdisciplinary approaches that combine techniques and perspectives from multiple scientific domains. Integrating structural biology with chemical biology could identify or design small molecules that modulate fslJ-1 activity, creating valuable tools for dissecting its function in vivo and potentially revealing therapeutic applications . Combining systems biology approaches—including proteomics, transcriptomics, and metabolomics—with traditional genetic manipulations would provide multi-dimensional views of how fslJ-1 influences cellular networks during D. discoideum development and environmental response . Advanced imaging techniques from physics and engineering, such as super-resolution microscopy or label-free imaging methods, could reveal previously undetectable aspects of fslJ-1 localization, trafficking, or clustering during signaling events. Computational modeling approaches from systems biology could integrate experimental data into predictive frameworks that generate testable hypotheses about fslJ-1's role in cellular decision-making during development. Synthetic biology strategies might engineer novel cellular systems with modified or simplified fslJ-1 signaling networks, allowing researchers to determine minimal requirements for specific functions. Evolutionary developmental biology (evo-devo) approaches comparing fslJ-1 function across related Dictyostelid species with varying degrees of social complexity could illuminate how signaling systems evolve in the context of increasing multicellular organization . Applying machine learning algorithms to analyze patterns in high-dimensional datasets related to fslJ-1 could identify non-obvious correlations and generate novel hypotheses about its function. Finally, collaborative efforts between specialists in protein biochemistry, developmental biology, evolutionary biology, and computational science would bring diverse expertise to bear on the complex questions surrounding fslJ-1 function in cellular signaling and organismal development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.