Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein K (fslK)

Shipped with Ice Packs
In Stock

Description

Introduction to Dictyostelium discoideum and fslK

Dictyostelium discoideum is a social amoeba commonly known as slime mold that serves as an important model organism for studying fundamental cellular processes including cell signaling, differentiation, and development. This organism possesses a unique life cycle transitioning between unicellular and multicellular stages, providing valuable insights into evolutionary conserved mechanisms of cell-cell communication and tissue formation . Within the genome of D. discoideum, several genes encoding transmembrane receptors have been identified, including the gene for Frizzled and smoothened-like protein K (fslK).

The fslK protein belongs to a specialized class of transmembrane proteins that share structural similarities with both Frizzled and Smoothened receptors . In classical systems, Frizzled proteins function as receptors for Wnt ligands, while Smoothened participates in Hedgehog signaling pathways. Both pathways play crucial roles in development, cell differentiation, and tissue patterning across diverse species. The presence of fslK in D. discoideum suggests potential evolutionary conservation of certain aspects of these signaling pathways, though its specific functions may be adapted to the unique biology of this organism.

The gene encoding fslK (also referred to as DDB_G0284729) produces a protein identified by UniProt accession number Q54PA5 . Understanding the structure, production methods, and potential functions of this protein contributes to our broader knowledge of cellular signaling mechanisms in this important model organism and may provide evolutionary insights into the development of complex multicellular signaling systems.

Expression Systems and Methodology

Recombinant fslK protein is produced using Escherichia coli (E. coli) as an expression system . This bacterial expression system offers several advantages for protein production, including rapid growth, well-characterized genetics, and high protein yield. The recombinant protein consists of amino acids 19-580 of the native fslK protein, representing the full length of the mature protein with an N-terminal histidine tag added to facilitate purification through affinity chromatography .

Functional Characterization Studies

While specific research applications of recombinant fslK are not extensively documented in the available search results, several potential applications can be inferred based on its classification and the typical research approaches used for membrane receptors:

The recombinant protein could be employed in receptor-ligand binding assays to identify potential signaling molecules that interact with fslK. Based on its classification as a Frizzled-like protein, it may interact with Wnt-like molecules or other developmental signaling factors present in Dictyostelium discoideum. Identifying these interaction partners would provide valuable insights into the signaling pathways in which fslK participates.

Functional studies using the recombinant protein might also explore its potential role in cellular processes characteristic of Dictyostelium, such as chemotaxis, aggregation, or morphogenesis. Prior research has established that G protein-coupled receptors, such as GrlH, function as receptors for autocrine signals that regulate proliferation and chemorepulsion in D. discoideum . As a potential GPCR-like protein, fslK might participate in similar signaling networks that coordinate cellular behaviors during the organism's complex life cycle.

Potential Signaling Roles

As a member of the Frizzled and Smoothened-like protein family, fslK likely participates in signaling pathways that regulate cellular behaviors in Dictyostelium discoideum. In other organisms, Frizzled proteins typically function as receptors for Wnt ligands, while Smoothened proteins participate in Hedgehog signaling. Both pathways play crucial roles in development, differentiation, and pattern formation.

While the specific signaling pathways in which fslK participates have not been extensively characterized in the available literature, research on other G protein-coupled receptors in Dictyostelium provides contextual understanding. For instance, the GrlH receptor has been identified as mediating AprA signaling, which regulates proliferation and chemorepulsion in this organism . By analogy, fslK might participate in similar autocrine signaling processes that coordinate cellular behaviors during development.

Evolutionary Significance

The presence of a Frizzled and Smoothened-like protein in Dictyostelium discoideum is particularly interesting from an evolutionary perspective. Dictyostelium occupies a unique phylogenetic position, having diverged after the plant-animal split but before the divergence of fungi and animals . This positioning makes it valuable for studying the evolution of signaling pathways that are found in higher eukaryotes.

The hybrid classification of fslK as both Frizzled and Smoothened-like suggests it might represent an ancestral form of these receptor types before their functional divergence in more complex organisms. Studying fslK could therefore provide insights into the evolutionary origins of Wnt and Hedgehog signaling pathways, which play crucial roles in animal development and tissue homeostasis.

Relationship to Other Dictyostelium Receptors

Dictyostelium discoideum possesses several families of receptors involved in various signaling processes. The genome of D. discoideum has been found to encode 11 Roco proteins, which function in various cellular processes including development and cytokinesis . While fslK is not classified as a Roco protein, understanding the diverse receptor families in Dictyostelium provides context for studying specialized receptors like fslK.

Research has also identified G protein-coupled receptors that mediate specific functions in Dictyostelium. For example, GrlH has been characterized as a receptor for the autocrine signal AprA, which inhibits proliferation and induces chemorepulsion . This demonstrates that diverse receptor-mediated signaling systems operate in Dictyostelium to coordinate cellular behaviors and development.

Comparison with Classical Frizzled Proteins

Classical Frizzled proteins in animals typically function as receptors for Wnt ligands and signal through both canonical (β-catenin-dependent) and non-canonical pathways to regulate diverse cellular processes including cell proliferation, migration, polarity, and differentiation. The classification of fslK as a Frizzled-like protein suggests potential structural or functional similarities, though the specific signaling mechanisms in Dictyostelium may differ significantly.

One notable difference is that while the Dictyostelium genome contains frizzled-like genes, traditional Wnt genes have not been definitively identified in this organism. This suggests that fslK might interact with alternative ligands or participate in Dictyostelium-specific signaling mechanisms that have evolved independently from but parallel to Wnt signaling in animals.

Functional Genomics Approaches

Future research on fslK could benefit from functional genomics approaches including:

  1. CRISPR-Cas9 mediated gene knockout studies to observe the phenotypic effects of fslK deletion

  2. Gene expression analysis to identify conditions under which fslK is upregulated or downregulated

  3. Protein interaction studies to identify binding partners and potential signaling components downstream of fslK

  4. Comparative genomics analyses across related Dictyostelium species to understand evolutionary conservation and divergence

These approaches would help elucidate the biological functions of fslK and its significance in Dictyostelium biology.

Developmental Biology Applications

Given the importance of Frizzled-like receptors in developmental processes, investigating the role of fslK during Dictyostelium development represents a promising research direction. Specific questions to address include:

  1. How is fslK expression regulated during the transition from unicellular to multicellular stages?

  2. Does fslK participate in cell-cell communication during aggregation or morphogenesis?

  3. Are there stage-specific roles for fslK during fruiting body formation?

  4. How does fslK signaling integrate with other known developmental pathways in Dictyostelium?

Research addressing these questions would contribute not only to our understanding of Dictyostelium biology but also to broader questions about the evolution of developmental signaling systems.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
fslK; DDB_G0284729; Frizzled and smoothened-like protein K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-580
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslK
Target Protein Sequence
QQYYPIDPTGKCEQYIGDSVITPCNSIYVSSTANQSTAMLSLNLYFSLLGGSSASCQNAY TFATLCSTYLPECEIFIDNSTNKEIAMPKRVCLDTCNSVSKNCQITSYFDCNQLEPISKL PLFPKESSDYNLTTYGGELNYRLDCYDPPKSNETTVIGYCPFPLVFRNRTIVGKGSDSLD NSENYGYTYVSEDSYCTIPCPAPIFSEKQWDNIFDTSDAISLVSLLCSVYLFITYMVINP KRNKYDYFFSFFVLSIILMSIAGTIGFSVGGTRKLLCPEINRRGVYTDPAVAAAGWIFQF AIINAILWFSINSFELWFQIKFIKRKLHLIKFYILAVLVISIALSVPLSAIGEFNAGLGN FVVWIESGKYQNWFFWGPLGIVLTVGTTFIGLVIWEIYKIVSSTNKSDFFKLQLKPLMNM LLIYLTFVYLFGYNFYIHNSLNGFYGSSEEFKNCIISTDGKDCRIQGPPYSSILMFVFCL RIYGVYCIALYGFSPKTRSIWSNSIVFNNSMANKLKTLYISSGTTKGGTSSTDIKMSTNN NSNMDSGGGKSSSMEPDEIILR
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What signaling pathways does fslK participate in within Dictyostelium discoideum?

The Frizzled and smoothened-like protein K in Dictyostelium appears to function in multiple signaling cascades that regulate critical cellular processes. Based on structural homology and knockout studies, fslK likely participates in pathways similar to those of other Frizzled family proteins, including potential roles in non-canonical Wnt/Ca²⁺ pathways and planar cell polarity (PCP) signaling .

In the Wnt/calcium pathway, Frizzled proteins typically act through heterotrimeric G proteins to activate phospholipase C (PLC) and phosphodiesterase (PDE) . This activation leads to increased concentrations of free intracellular calcium [Ca²⁺]ᵢ and decreased intracellular concentrations of cyclic guanosine monophosphate (cGMP), respectively . The involvement of fslK in these pathways is particularly interesting because knockout studies have revealed that fslK-deficient cells fail to aggregate during development, suggesting its critical role in early developmental signaling .

Research indicates that fslK likely interfaces with the cAMP signaling machinery that is crucial for Dictyostelium aggregation. The expression level of adenylyl cyclase A (ACA) decreases with the progression of aggregation to the mound stage, coinciding with developmental changes that form precursor cells found within the mature fruiting body . The inability of fslK knockout cells to aggregate suggests that this protein may regulate or respond to changes in cAMP levels during development, potentially through calcium signaling mechanisms that are conserved across Frizzled family proteins .

What are the optimal expression conditions for recombinant fslK protein in heterologous systems?

Optimizing expression of recombinant Dictyostelium discoideum fslK protein requires careful consideration of several parameters, particularly codon usage and translation initiation sequences. Dictyostelium has a genome with an AT content of >75%, resulting in a codon bias significantly different from human or other mammalian systems .

For efficient expression in E. coli (the most common heterologous system for this protein), the following conditions are critical:

The following table summarizes the codon usage frequencies in Dictyostelium, which should be considered when designing expression constructs:

Amino AcidPreferred CodonUsage (%)Avoid CodonsUsage (%)
Leu (L)TTA55.5CTG0.7
Gln (Q)CAA97.0CAG3.0
Arg (R)AGA59.9CGC, CGG0.6, 0.3
Gly (G)GGT80.0GGC, GGG4.6, 1.3
Pro (P)CCA84.3CCG1.3

How do researchers create and validate fslK knockout mutants in Dictyostelium?

Creating and validating fslK knockout mutants in Dictyostelium requires a systematic approach that combines molecular genetic techniques with phenotypic characterization. Based on established protocols for generating Dictyostelium knockout strains, the following methodological approach is recommended:

  • Knockout construct design: Generate a construct containing a selectable marker (typically a blasticidin or G418 resistance cassette) flanked by sequences homologous to the regions upstream and downstream of the fslK gene. This design facilitates homologous recombination and replacement of the target gene with the selectable marker .

  • Transformation: Introduce the knockout construct into Dictyostelium cells via electroporation. Typical electroporation parameters include using specialized cuvettes with parameters optimized for Dictyostelium transformation .

  • Selection: Apply the appropriate antibiotic selection to identify transformants that have integrated the knockout construct. Single colonies are isolated and expanded for further validation .

  • Molecular validation: Confirm the knockout using PCR with primers that flank the integration site, and verify the absence of the wild-type gene and the presence of the resistance cassette. Southern blotting can provide additional confirmation of the genomic modification .

  • Expression validation: Generate polyclonal antibodies against specific regions of the fslK protein (such as the C-terminus) to confirm the absence of protein expression in the knockout strain via Western blotting .

  • Phenotypic characterization: Validate the knockout by assessing its impact on:

    • Aggregation during development

    • Cell-cell adhesion properties

    • Cell migration capabilities

    • cAMP and calcium signaling responses

    • Cell fate determination during development

The knockout validation is considered complete when both molecular evidence confirms the genetic modification and phenotypic analysis demonstrates functional consequences consistent with the loss of the target protein. For fslK, knockout cells have been shown to survive as amoebae but fail to aggregate during the developmental cycle, suggesting a critical role in early development and cell-cell communication .

What techniques are most effective for studying fslK membrane localization and trafficking?

Studying the membrane localization and trafficking of fslK protein in Dictyostelium requires a combination of molecular biology, biochemistry, and advanced microscopy techniques. Given the transmembrane nature of this Frizzled-like protein, the following approaches are most effective:

  • Fluorescent protein tagging: Creating fusion constructs of fslK with fluorescent proteins (e.g., GFP, mCherry) allows for live-cell imaging of protein localization and trafficking. When designing these constructs, it's critical to consider whether N- or C-terminal tagging is more appropriate, as the unique C-terminal PIP5K domain may have functional implications that could be disrupted by C-terminal tags .

  • Subcellular fractionation: This biochemical approach involves separating membrane fractions from cytosolic components through differential centrifugation. Western blotting of these fractions using anti-fslK antibodies can confirm the protein's presence in specific membrane compartments .

  • Immunofluorescence microscopy: Using polyclonal antibodies against specific regions of fslK (such as those generated against the C-terminus) in fixed cells allows for visualization of the endogenous protein without the potential artifacts of overexpression systems .

  • Confocal microscopy with calcium indicators: Since fslK may be involved in calcium signaling pathways similar to other Frizzled family members, combining localization studies with calcium indicators can provide insights into functional correlations between protein localization and signaling activities .

  • TIRF microscopy: Total Internal Reflection Fluorescence microscopy is particularly useful for observing membrane-proximal events and can provide high-resolution data on the dynamics of fslK within the plasma membrane or during endocytic/exocytic processes.

  • Photobleaching techniques: Fluorescence Recovery After Photobleaching (FRAP) or photoactivation techniques can be employed to study the mobility of fslK within membranes and determine if it forms stable complexes or exhibits dynamic behavior.

Researchers should be aware that the unique structural features of fslK, including its shorter N-terminus and lack of the classical CRD region, may influence its membrane topology and trafficking patterns compared to canonical Frizzled receptors in other systems .

What role does fslK play in Dictyostelium development and morphogenesis?

The role of fslK in Dictyostelium development appears to be critical, particularly during the early stages of multicellular formation. Knockout studies have provided significant insights into its function during morphogenesis:

  • Aggregation: FslK knockout cells (fslK−) fail to aggregate during the developmental cycle, indicating that this protein is essential for the initial step of multicellular development . This aggregation defect suggests that fslK may be involved in sensing or transducing signals that coordinate collective cell behavior.

  • cAMP signaling: The inability to aggregate may be linked to defects in cAMP signaling, which is the primary chemoattractant coordinating Dictyostelium development. FslK likely interfaces with the cAMP signaling machinery, potentially through interactions with adenylyl cyclase (ACA) or phosphodiesterase (PDE) activities that regulate cAMP levels .

  • Cell-cell adhesion: Detailed analysis of fslK− mutants has revealed defects in cell-cell adhesion, which is a prerequisite for stable aggregate formation . This suggests that fslK may influence the expression or function of cell adhesion molecules during development.

  • Calcium signaling: Given the homology of fslK to Frizzled family proteins involved in non-canonical Wnt/Ca²⁺ pathways, it likely participates in calcium-dependent signaling events during morphogenesis . Altered calcium dynamics in fslK− cells may contribute to developmental defects.

  • Cell fate determination: Analysis of fslK− mutants indicates that this protein plays a role in cell fate specification during development . The inability to progress beyond the aggregation stage prevents the formation of diverse cell types that normally comprise the mature fruiting body.

  • Cell migration: Coordinated cell movement is essential for morphogenesis, and fslK appears to regulate aspects of cell migration during development . This may involve cytoskeletal reorganization in response to directional cues.

The developmental role of fslK appears to be most pronounced during the transition from unicellular growth to multicellular development, highlighting its importance in the signaling networks that enable collective cell behavior and tissue formation in this model organism .

How does fslK compare structurally and functionally to other Frizzled family proteins?

Frizzled and smoothened-like protein K (fslK) exhibits both important similarities and notable differences when compared to other Frizzled family proteins in terms of structure and function:

Structural Comparisons:

  • Transmembrane domain: FslK contains the characteristic seven-transmembrane domain structure that defines the Frizzled receptor family, with sequence homologies that place it specifically in the smoothened Frizzled receptor subfamily .

  • N-terminal region: Unlike classical Frizzled receptors, fslK has a relatively short N-terminus that critically lacks the extracellular cysteine-rich domain (CRD) . The CRD typically serves as the binding site for Wnt ligands in canonical Frizzled receptors, suggesting that fslK may respond to different ligands or function in a ligand-independent manner.

  • C-terminal domain: FslK possesses a unique C-terminal domain containing a Phosphatidylinositol-4-phosphate 5-kinase (PIP5K) motif . This domain is not typically found in other Frizzled family members and suggests specialized signaling capabilities potentially involving phosphoinositide metabolism.

  • Amino acid composition: The full-length mature protein (amino acids 19-580) contains structural motifs consistent with G-protein coupled receptor (GPCR) functionality, similar to other Frizzled receptors .

Functional Comparisons:

The structural and functional peculiarities of fslK make it an interesting model for studying the evolution of this receptor family and may provide insights into the ancestral functions of Frizzled-like proteins before the emergence of canonical Wnt signaling.

What are the optimal methods for studying fslK protein-protein interactions in Dictyostelium?

Investigating protein-protein interactions involving fslK requires specialized approaches that account for its membrane localization and unique structural features. The following methodologies are particularly effective for studying fslK interactions in Dictyostelium:

  • Co-immunoprecipitation (Co-IP): This technique remains a gold standard for detecting protein interactions. For membrane proteins like fslK, optimized lysis conditions using mild detergents (such as CHAPS or digitonin) that preserve membrane protein complexes are essential. Using antibodies against the C-terminal region of fslK has proven effective for immunoprecipitation studies .

  • Proximity-based labeling: Techniques such as BioID or APEX2 proximity labeling, where fslK is fused to a biotin ligase or peroxidase, allow for identification of proteins that come into close proximity with fslK in living cells. This approach is particularly valuable for identifying transient or weak interactions that might be disrupted during traditional Co-IP procedures.

  • FRET/BRET analysis: Fluorescence or Bioluminescence Resonance Energy Transfer techniques allow for detection of direct protein interactions in living cells. By creating fusion constructs of fslK and potential binding partners with appropriate fluorophore or luciferase pairs, interactions can be monitored in real-time under physiological conditions.

  • Yeast two-hybrid membrane system: Modified yeast two-hybrid systems designed specifically for membrane proteins (such as the split-ubiquitin system) can be employed to screen for fslK interacting partners, though validation in Dictyostelium would be required for any identified candidates.

  • Mass spectrometry-based approaches: Quantitative proteomic methods such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with Co-IP can identify differential binding partners between wild-type and mutant fslK variants, or between stimulated and unstimulated conditions.

  • Chemical cross-linking: Prior to cell lysis, membrane-permeable cross-linkers can be used to stabilize protein complexes that might otherwise dissociate during purification procedures, enhancing the detection of weak or transient interactions.

When designing interaction studies, it's important to consider the specific domains of fslK that might mediate different interactions. The unique C-terminal PIP5K domain likely participates in distinct interaction networks compared to the seven-transmembrane region . Additionally, the potential involvement of fslK in G-protein signaling suggests that interactions with G-protein subunits should be specifically investigated .

How can researchers optimize codon usage for maximum fslK expression in heterologous systems?

Optimizing codon usage for maximum expression of fslK in heterologous systems requires a strategic approach based on understanding the unique codon preferences of Dictyostelium and the host expression system. Research on heterologous protein expression in Dictyostelium provides valuable insights applicable to fslK expression optimization:

  • Focus on the 5' region: Studies have demonstrated that optimizing the first 5-17 codons of a gene contributes to a 4- to 5-fold increase in expression levels, while further optimization has minimal additional effect . This suggests that optimal codon usage primarily affects ribosome stabilization during the initial phase of translation rather than the elongation phase.

  • Identify and replace rare codons: The Dictyostelium genome has an AT content of >75%, resulting in a significant codon bias toward AT-rich codons . When expressing fslK in heterologous systems, codons that are used with less than 1% frequency in Dictyostelium should be replaced with preferred codons, particularly within the first 17 codons of the sequence. The following table shows examples of rarely used codons in Dictyostelium:

Amino AcidRarely Used CodonUsage (%)Preferred ReplacementUsage (%)
LeuCTG0.7TTA55.5
ArgCGC0.6AGA59.9
ArgCGG0.3AGA59.9
GlyGGG1.3GGT80.0
ProCCG1.3CCA84.3
AlaGCG1.3GCT40.5
  • Optimize translation initiation: Adapting the 5'-sequence immediately upstream of the ATG start codon to match the Dictyostelium 'Kozak'-like sequence (AAAAA) can increase expression levels by approximately 1.5-fold . Even when expressing in E. coli or other systems, optimizing this region for the host's preferred translation initiation context is important.

  • Combine optimization strategies: Using both codon optimization and translation initiation sequence adaptation can result in a combined 6- to 8-fold increase in expression levels .

  • Consider expression system-specific requirements: When expressing fslK in E. coli (a common heterologous host), additional considerations include:

    • Avoiding secondary structure formation in the mRNA

    • Eliminating internal Shine-Dalgarno-like sequences

    • Considering codon pair bias of the host organism

By implementing these codon optimization strategies, researchers can significantly enhance the expression of recombinant fslK protein, facilitating structural and functional studies that require substantial amounts of purified protein .

What analytical techniques are most appropriate for characterizing fslK protein folding and stability?

Characterizing the folding and stability of fslK protein requires specialized techniques that account for its membrane-associated nature. The following analytical approaches are particularly valuable for investigating recombinant fslK protein structure and stability:

  • Circular Dichroism (CD) Spectroscopy: This technique provides information about secondary structure content (α-helices, β-sheets) and can be used to monitor thermal or chemical denaturation of fslK in detergent micelles or reconstituted liposomes. Far-UV CD (190-250 nm) is particularly useful for assessing changes in secondary structure under varying conditions.

  • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence can serve as a probe for tertiary structure changes. The fslK sequence contains tryptophan residues that can be monitored for changes in their local environment during folding/unfolding transitions .

  • Differential Scanning Calorimetry (DSC): This technique measures heat capacity changes during protein unfolding and can provide thermodynamic parameters related to protein stability, particularly useful for comparing wild-type fslK to mutant variants.

  • Limited Proteolysis coupled with Mass Spectrometry: This approach identifies protease-accessible regions in the protein structure, providing insights into domain organization and folding status. Comparing digestion patterns under different conditions can reveal structural transitions.

  • Size-Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): This combination allows for determination of the oligomeric state and homogeneity of fslK preparations in detergent solutions, which is crucial for ensuring proper folding.

  • Thermal Shift Assays: Modified for membrane proteins using environmentally sensitive fluorescent dyes, these assays can screen conditions (detergents, lipids, buffer components) that enhance protein stability.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique provides information about solvent accessibility of different protein regions and can reveal details about fslK conformational dynamics and domain structure.

  • Cysteine Accessibility Assays: The fslK sequence contains multiple cysteine residues whose accessibility to thiol-reactive reagents can provide information about protein folding and topology in membrane environments.

When working with recombinant fslK protein, storage and handling considerations are critical for maintaining stability:

  • Store as lyophilized powder at -20°C/-80°C

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

These analytical approaches, combined with proper handling techniques, provide comprehensive information about fslK protein folding, stability, and structural dynamics, which is essential for understanding its function in cellular signaling pathways.

What is the current understanding of fslK's role in calcium signaling in Dictyostelium?

The role of fslK in calcium signaling in Dictyostelium appears to parallel aspects of non-canonical Wnt/Ca²⁺ signaling pathways seen in other organisms, though with unique features specific to this social amoeba. Current understanding of fslK's involvement in calcium signaling is based on several lines of evidence:

  • Homology to Frizzled receptors: FslK belongs to the Frizzled receptor family, members of which are known to participate in non-canonical Wnt/Ca²⁺ pathways in other organisms . In these pathways, Frizzled activation leads to increased concentrations of free intracellular calcium [Ca²⁺]ᵢ through G-protein-mediated activation of phospholipase C (PLC) .

  • G-protein coupling: Like other Frizzled family members, fslK likely functions through heterotrimeric G-proteins that can activate PLC, leading to the generation of inositol trisphosphate (IP₃) and subsequent calcium release from intracellular stores .

  • Developmental defects in knockout strains: The failure of fslK knockout cells to aggregate during development is consistent with disrupted calcium signaling, as calcium oscillations are known to be important for Dictyostelium chemotaxis and aggregation.

  • PIP5K domain involvement: The unique C-terminal PIP5K domain of fslK suggests it may directly influence phosphoinositide metabolism, which is upstream of calcium signaling pathways. PIP5K generates phosphatidylinositol 4,5-bisphosphate (PIP₂), which serves as the substrate for PLC in generating IP₃.

  • Integration with cAMP signaling: Calcium signaling in Dictyostelium is tightly integrated with cAMP signaling during aggregation. The expression level of adenylyl cyclase A (ACA) decreases with the progression from aggregation to the mound stage , and fslK may be involved in regulating this process through calcium-dependent mechanisms.

  • Potential interaction with phosphodiesterase (PDE): In the non-canonical Wnt pathway, Frizzled activation can also lead to activation of PDE , which decreases intracellular cGMP levels. In Dictyostelium, PDE is regulated by a phosphodiesterase inhibitor (PDI) that is induced at low levels of cAMP . FslK may influence this regulatory mechanism, connecting calcium signaling to cAMP/cGMP metabolism.

While these connections suggest important roles for fslK in calcium signaling, direct measurements of calcium dynamics in fslK mutants and identification of specific downstream effectors would provide more definitive insights into the precise mechanisms by which this protein influences calcium-dependent processes during Dictyostelium development and cell behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.