Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein L (fslL)

Shipped with Ice Packs
In Stock

Description

Introduction to Frizzled and Smoothened-Like Proteins in Dictyostelium discoideum

Dictyostelium discoideum, a soil-dwelling amoebozoan, expresses a family of Frizzled and smoothened-like (Fsl) proteins that share structural homology with metazoan Frizzled receptors and Smoothened proteins involved in Wnt and Hedgehog signaling pathways . These proteins contain cysteine-rich domains (CRDs) critical for ligand binding and signal transduction . While the specific protein "fslL" is not explicitly documented in current literature, related Fsl proteins (e.g., fslA, fslD, fscH) have been characterized, enabling inferences about their structural and functional roles .

Recombinant Production and Applications

Recombinant Fsl proteins are produced using mammalian expression systems to ensure proper post-translational modifications. For example:

  • Expression: Proteins like fslA are expressed in mammalian cells with Tris-based storage buffers and glycerol stabilizers .

  • Purity: >85% purity via SDS-PAGE .

  • Functional Studies: Used to investigate evolutionary conservation of Wnt/Hedgehog signaling mechanisms in non-metazoans .

Key Research Findings:

  • Evolutionary Insights: Fsl proteins in D. discoideum lack canonical Wnt ligands but retain CRDs for unknown ligands, suggesting divergent signaling roles .

  • Secretory Efficiency: Recombinant proteins like fslA and glutathione-S-transferase (GST) are secreted efficiently, yielding up to 20 mg/L .

Research Implications and Gaps

While fslL remains uncharacterized, studies on related Fsl proteins highlight:

  • Model System Utility: D. discoideum serves as a platform for studying CRD evolution and GPCR-like signaling .

  • Unresolved Questions: The ligand specificity and downstream pathways of Fsl proteins are poorly understood .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include a note with your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
fslL; DDB_G0284585; Frizzled and smoothened-like protein L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-619
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslL
Target Protein Sequence
QEEYPIDQTGKCEPYIGDSQITKCSTFLPNINSIYVSANSTQKDSMKTLDNYFGLLLAVG SEKCKDSSLTYQTLCSMYLKECESFTDNSTLKTVSIPKRICRKTCNDVTKLCNIESLFNC SQNEPINNLPLCPLNYSIYDLSLVNGDSNYELQCYSPLSNDSIEIPVTNYCPFPLIYINS TDHSADEDRGYMFVSGNSNCVVPNPVPLYTPKQWDRLYDLSNSLSVLSCVGTLFLLFTFN ILNKKINRFDRMNSLFNGSVFMMSLSGVIILFAGGPRALIKDGGARISVWQDPLCSATGF IFQLFSIAAILFWVVMSFELWYKIKFMTKKLDLKKYYIPFIIIVSLVFSIIPLATKNYRM IRGNMHCWVHTTKLQNSLFWIPLGIAITIGTIFIGLVMFEIHRIVSANSKGGVLKLEIKS ILNVALIYLTFIYLFAFNFYMNGQEGVVYGQIESFYQCTLENDASECTIQGPSIGSLGFF IFCIRIYGVYCFILQGLNYRAYNIWKESIFFNNRFVSYIKNNILNIETSSTGSGGTSTTA SATTTTTTKKHNGIDSLNIDSAFSKNNESDDEDDYDPYKKSKNNITLKDIEVSKS
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum Frizzled and smoothened-like protein L (fslL)?

Frizzled and smoothened-like protein L (fslL) is a transmembrane protein found in the social amoeba Dictyostelium discoideum. It belongs to a family of proteins related to Frizzled receptors, which are known to function in Wnt signaling pathways in metazoans . The full-length mature protein spans amino acids 25-619 and contains characteristic cysteine-rich domains (CRDs) similar to those found in Frizzled receptors . The protein is encoded by the fslL gene (also designated as DDB_G0284585) in D. discoideum . Unlike typical metazoan Frizzled receptors, Dictyostelium Frizzled-like proteins represent an evolutionary distinct branch that provides insights into the origins and diversification of these signaling components.

How is recombinant fslL protein typically produced?

Recombinant fslL protein production typically involves heterologous expression systems. Based on the available information:

  • Expression Host: E. coli is commonly used for the expression of recombinant fslL protein . This bacterial system allows for high-yield production of the protein, although it may lack some post-translational modifications found in the native protein.

  • Fusion Tags: The recombinant protein is often produced with an N-terminal His-tag to facilitate purification through affinity chromatography . The His-tag allows for single-step purification using metal chelate affinity resins.

  • Protein Fragment: The mature protein spanning amino acids 25-619 is typically used for recombinant expression rather than the full-length protein including the signal peptide .

  • Purification: After expression, the protein is purified to >90% purity as determined by SDS-PAGE and typically supplied as a lyophilized powder .

  • Alternative Expression Systems: While E. coli is commonly used, researchers exploring functional studies may consider Dictyostelium itself as an expression system, as it possesses the cellular machinery for proper eukaryotic post-translational modifications .

What is the relationship between fslL and signaling pathways in Dictyostelium discoideum?

The exact signaling role of fslL in Dictyostelium discoideum is not fully characterized in the provided search results, but several insights can be drawn:

  • Evolutionary Context: fslL belongs to a family of Frizzled-like proteins in Dictyostelium that are evolutionarily related to metazoan Frizzled receptors, which function in Wnt signaling pathways .

  • Structural Homology: The presence of a Frizzled-type cysteine-rich domain (FZ-CRD) suggests potential ligand-binding capabilities similar to those of Frizzled receptors in higher organisms .

  • Developmental Processes: Given the role of Dictyostelium as a model organism for studying developmental processes and cell-cell communication, fslL may participate in signaling events during the transition from single-cell to multicellular stages .

  • Comparative Analysis: The study of fslL in Dictyostelium provides an opportunity to understand the evolutionary origins of Wnt and Hedgehog signaling components before the emergence of metazoans .

How does fslL compare structurally and functionally to other Frizzled-like proteins in Dictyostelium?

Dictyostelium discoideum contains multiple Frizzled-like proteins that represent an interesting evolutionary case study:

  • Evolutionary Distinctiveness: Frizzled-like proteins in Dictyostelium represent an evolutionary branch distinct from metazoan Frizzled receptors but sharing common structural features through the FZ-CRD domain .

  • Structural Comparison: The cysteine-rich domains (CRDs) in Dictyostelium Frizzled-like proteins maintain the characteristic disulfide connectivity pattern seen in metazoan counterparts, despite sequence divergence .

  • Functional Diversity: Different Frizzled-like proteins in Dictyostelium may have specialized functions in various developmental stages or environmental responses, though specific functional comparison data between fslL and other family members is limited in the provided search results.

  • Nomenclature Context: The designation "L" in fslL suggests it is one member of a larger family of Frizzled and smoothened-like proteins in Dictyostelium, implying the existence of other members (possibly fslA, fslB, etc.) with potentially distinct functions .

  • Evolutionary Significance: Studying the differences between fslL and other Frizzled-like proteins in Dictyostelium provides insights into the early evolution of these signaling components before the divergence of metazoan lineages .

What experimental methods are optimal for studying fslL function in Dictyostelium?

Several experimental approaches are particularly valuable for investigating fslL function:

  • Genetic Manipulation:

    • Knockout studies using mutants (similar to existing atg1-, kil1-, kil2-, and atg6- mutants used in Dictyostelium research)

    • CRISPR-Cas9 gene editing to introduce specific mutations or tags

    • RNA interference to achieve knockdown of fslL expression

  • Protein Localization Studies:

    • Fluorescent protein tagging (GFP, RFP) of fslL to track subcellular localization

    • Immunofluorescence using antibodies against fslL or its epitope tags

    • Fractionation studies to determine membrane association

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation to identify binding partners

    • Yeast two-hybrid screening

    • Proximity labeling techniques (BioID, APEX)

    • Surface plasmon resonance using purified recombinant proteins

  • Developmental Studies:

    • Analysis of fslL expression during different stages of Dictyostelium development

    • Phenotypic assessment of fslL mutants during development on bacterial lawns

    • Co-cultivation assays with bacteria or yeast to assess impact on phagocytosis and predation

  • Signaling Pathway Analysis:

    • Phosphorylation studies to identify downstream targets

    • Transcriptome analysis (RNA-seq) of wild-type versus fslL mutants

    • Calcium imaging to assess potential roles in calcium signaling

How can recombinant fslL be used to investigate signal transduction pathways?

Recombinant fslL protein can serve as a valuable tool for investigating signal transduction:

  • Ligand Binding Studies:

    • Use purified recombinant fslL to identify potential ligands through binding assays

    • Employ domain-specific fragments to map ligand interaction sites

    • Perform competition assays with known Frizzled ligands to assess binding specificity

  • Structure-Function Analysis:

    • Mutational analysis of key residues in the CRD to determine their impact on ligand binding

    • Assessment of conformational changes upon ligand binding using biophysical techniques

    • Comparison of binding properties with metazoan Frizzled proteins

  • Pathway Reconstitution:

    • Use recombinant protein to reconstitute signaling components in cell-free systems

    • Develop in vitro assays to measure downstream signaling events

    • Test the effects of potential inhibitors or activators on pathway components

  • Receptor Dynamics:

    • Study receptor oligomerization and clustering using labeled recombinant protein

    • Analyze membrane insertion and topology using artificial membrane systems

    • Investigate the impact of post-translational modifications on receptor function

  • Cross-Species Comparisons:

    • Test functional complementation between Dictyostelium fslL and metazoan Frizzled proteins

    • Compare ligand specificity across evolutionary diverse systems

    • Identify conserved signaling mechanisms between Dictyostelium and higher organisms

What are the challenges in expressing functional fslL protein and how can they be addressed?

Expressing functional fslL protein presents several challenges:

  • Transmembrane Nature:

    • Challenge: As a seven-transmembrane protein, fslL is difficult to express in soluble, correctly folded form.

    • Solution: Use specialized expression systems designed for membrane proteins, such as cell-free systems with added detergents or lipids.

  • Disulfide Bond Formation:

    • Challenge: The cysteine-rich domain requires proper formation of disulfide bonds.

    • Solution: Expression in eukaryotic systems or bacterial strains engineered to facilitate disulfide bond formation (e.g., SHuffle® E. coli).

  • Post-Translational Modifications:

    • Challenge: Potential glycosylation or other modifications may be required for function.

    • Solution: Consider Dictyostelium itself as an expression host, as it possesses eukaryotic post-translational modification machinery .

  • Protein Stability:

    • Challenge: Recombinant fslL is sensitive to freeze-thaw cycles .

    • Solution: Store working aliquots at 4°C for up to one week; add glycerol (5-50%) for long-term storage at -20°C/-80°C .

  • Reconstitution Challenges:

    • Challenge: Proper reconstitution of lyophilized protein.

    • Solution: Brief centrifugation before opening, reconstitution in deionized sterile water to 0.1-1.0 mg/mL concentration .

ChallengeRecommended Solution
Transmembrane protein expressionUse specialized membrane protein expression systems
Disulfide bond formationExpression in SHuffle® E. coli or eukaryotic systems
Post-translational modificationsConsider Dictyostelium as expression host
Protein stabilityAvoid freeze-thaw cycles; use glycerol for storage
ReconstitutionCarefully follow reconstitution protocol with proper buffer

How do mutations in fslL affect Dictyostelium discoideum development and pathogen interactions?

While specific information about fslL mutations is limited in the search results, we can infer potential impacts based on related research:

  • Developmental Processes:

    • Mutations in signaling components often affect Dictyostelium's transition from unicellular to multicellular stages

    • fslL mutations might disrupt cell-cell communication necessary for aggregation and morphogenesis

  • Phagocytosis and Bacterial Interactions:

    • Dictyostelium uses various proteins for bacterial predation, and mutations in key components like kil1 affect bacteriolytic activity

    • If fslL plays a role in sensing bacterial presence or regulating phagocytosis, mutations could alter Dictyostelium's ability to consume bacteria

  • Yeast Interactions:

    • Dictyostelium serves as a host model for studying interactions with yeasts like Saccharomyces cerevisiae and Candida species

    • Mutations in genes like atg1, kil1, and kil2 increase Dictyostelium's ability to predate yeast cells, while atg6 mutations decrease this ability

    • fslL mutations might similarly impact interactions with fungal cells

  • Signaling Pathway Disruption:

    • As a potential component of evolutionarily conserved signaling pathways, fslL mutations could disrupt downstream processes

    • Comparative studies with wild-type and mutant strains could reveal fslL's role in developmental gene expression

  • Cell Motility and Chemotaxis:

    • If fslL participates in sensing environmental cues, mutations might affect Dictyostelium's chemotactic responses

    • This could impact both developmental aggregation and predatory behavior

What are the optimal storage and handling conditions for recombinant fslL protein?

Proper storage and handling of recombinant fslL protein is critical for maintaining its structural integrity and functional activity:

  • Long-term Storage:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • For reconstituted protein, add 5-50% glycerol (final concentration) before storage at -20°C/-80°C, with 50% being the recommended default concentration

  • Short-term Storage:

    • Working aliquots can be stored at 4°C for up to one week

    • Repeated freezing and thawing is not recommended as it can degrade the protein

  • Buffer Conditions:

    • The protein is typically stored in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

    • Trehalose acts as a stabilizing agent for the lyophilized protein

  • Reconstitution Protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Allow complete dissolution before aliquoting or experimental use

  • Handling Precautions:

    • Avoid repeated pipetting of stock protein

    • Minimize exposure to room temperature

    • Use sterile technique to prevent contamination

    • Consider using low-binding tubes to prevent protein adhesion to tube walls

What expression systems are most suitable for producing functional fslL protein?

Different expression systems offer distinct advantages for producing functional fslL protein:

  • E. coli Expression System:

    • Currently used for commercial production of recombinant fslL

    • Advantages: High yield, simple genetic manipulation, cost-effective

    • Limitations: May lack proper eukaryotic post-translational modifications, potential issues with membrane protein folding

    • Recommended for: Basic structural studies, antibody production, interaction studies not dependent on glycosylation

  • Dictyostelium discoideum Expression System:

    • Homologous expression in the native organism

    • Advantages: Proper post-translational modifications, correct folding environment, appropriate membrane composition

    • Dictyostelium possesses "the complex cellular machinery required for orchestrating post-translational modifications similar to the one observed in higher eukaryotes"

    • Recommended for: Functional studies, in vivo localization, complex formation analysis

  • Yeast Expression Systems:

    • Alternative eukaryotic expression systems like Saccharomyces cerevisiae or Pichia pastoris

    • Advantages: Eukaryotic processing, higher yields than mammalian systems, secretion possible

    • Limitations: Glycosylation patterns differ from higher eukaryotes

    • Recommended for: Scaling up production while maintaining some eukaryotic processing

  • Baculovirus Expression System:

    • Insect cell-based expression

    • Advantages: "Proper protein modifications, processing, and refolding of complex proteins"

    • Recommended for: Production of functional membrane proteins with complex folding requirements

  • Mammalian Cell Expression:

    • HEK293, CHO or other mammalian cell lines

    • Advantages: Most similar post-translational modifications to higher eukaryotes

    • Limitations: Higher cost, lower yields

    • Recommended for: Studies requiring mammalian-type glycosylation or other modifications

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, low costLimited PTMsBasic research, structural studies
DictyosteliumNative environment, proper PTMsLower yieldsFunctional studies, in vivo analysis
YeastMedium yield, eukaryotic processingDifferent glycosylationScaled production with some PTMs
BaculovirusGood for complex proteinsMore complex setupFunctional membrane proteins
MammalianMost authentic PTMsHighest cost, lowest yieldStudies requiring mammalian PTMs

How can researchers validate the functionality of expressed fslL protein?

Validation of functional recombinant fslL protein requires multiple complementary approaches:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Thermal shift assays to assess protein stability and proper folding

    • Limited proteolysis to verify domain organization

    • Size exclusion chromatography to analyze oligomeric state

  • Ligand Binding Assays:

    • Surface plasmon resonance (SPR) to measure binding kinetics with potential ligands

    • Isothermal titration calorimetry (ITC) for quantitative binding parameters

    • Fluorescence-based binding assays with labeled ligands

    • Co-immunoprecipitation with potential binding partners

  • Functional Complementation:

    • Rescue experiments in fslL-deficient Dictyostelium strains

    • Assessment of developmental phenotypes in rescue experiments

    • Evaluation of phagocytic capacity restoration

    • Signaling pathway activation measurements

  • Domain-Specific Functionality:

    • Analysis of cysteine-rich domain (CRD) disulfide bond formation

    • Mutation of key residues to verify their importance for function

    • Comparison of binding properties with well-characterized Frizzled proteins

    • Evaluation of membrane integration for the transmembrane domains

  • In Cell Validation:

    • Cellular localization studies using fluorescently tagged protein

    • Responsiveness to stimuli that activate related signaling pathways

    • Protein-protein interaction network mapping

    • Downstream signaling activation measurements

What purification strategies yield the highest quality recombinant fslL protein?

Purifying high-quality functional fslL protein requires careful consideration of its transmembrane nature and structural complexity:

  • Initial Extraction:

    • For membrane proteins like fslL, use appropriate detergents (e.g., DDM, LMNG, or CHAPS) to solubilize from membranes

    • Consider using styrene-maleic acid lipid particles (SMALPs) to extract the protein with its native lipid environment

    • Optimize detergent:protein ratios to maintain structural integrity

  • Affinity Chromatography:

    • His-tag purification using Ni-NTA or TALON resin for His-tagged recombinant fslL

    • Consider tandem affinity purification (e.g., His-tag plus another tag) for higher purity

    • Optimize imidazole concentrations in washing and elution buffers to minimize non-specific binding

  • Size Exclusion Chromatography:

    • Secondary purification step to separate oligomeric states and remove aggregates

    • Use detergent-containing buffers throughout to maintain solubility

    • Analyze fractions for homogeneity using dynamic light scattering

  • Protein Quality Assessment:

    • SDS-PAGE analysis to confirm >90% purity

    • Western blotting to verify identity and integrity

    • Mass spectrometry to confirm complete sequence and modifications

    • Thermal stability assays to assess proper folding

  • Final Formulation:

    • Buffer exchange to Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Concentration determination using appropriate methods (UV absorption with calculated extinction coefficient)

    • Lyophilization for long-term storage or addition of glycerol for frozen storage

    • Aliquoting to avoid freeze-thaw cycles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.