Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein M (fslM-1)

Shipped with Ice Packs
In Stock

Description

Primary Sequence and Domains

fslM-1 is a 623-amino acid protein (UniProt ID: Q556N7) with:

  • N-terminal extracellular domain: Contains a conserved Frizzled cysteine-rich domain (CRD) critical for ligand binding .

  • Seven transmembrane helices: Characteristic of GPCRs, facilitating signal transduction .

  • C-terminal cytoplasmic domain: Includes a PDZ-binding motif for intracellular interactions .

Post-Translational Modifications

  • Glycosylation: One N-linked glycosylation site at position 57 .

  • Disulfide bonds: Ten conserved cysteines in the CRD form five disulfide bridges .

Expression and Purification

  • Expression system: E. coli (in vitro), yielding full-length protein with an N-terminal 10xHis tag .

  • Storage: Stable at -20°C (liquid) or -80°C (lyophilized); repeated freeze-thaw cycles are not recommended .

Role in Signaling Pathways

  • Class F GPCR homology: Shares structural features with human Frizzled receptors (e.g., FZD1–10) and Smoothened (SMO), implicating potential roles in Wnt or Hedgehog-like pathways .

  • Ligand interactions: While direct ligands for fslM-1 remain uncharacterized, Frizzled CRDs typically bind Wnt morphogens .

Research Applications

  • Structural studies: AlphaFold models enable hypothesis generation for mutagenesis and functional assays .

  • Drug discovery: Serves as a tractable model for class F GPCR activation mechanisms .

Comparative Analysis with Human Frizzled Receptors

FeaturefslM-1Human FZD1
Sequence Length623 aa647 aa
Transmembrane Helices77
CRD Cysteines1010
Expression SystemE. coliMammalian cells
Ligand SpecificityUnknownWnt proteins (e.g., Wnt3a)

Limitations and Future Directions

  • Functional data gaps: No experimental studies confirm fslM-1’s endogenous ligands or signaling partners .

  • Opportunities:

    • Use CRISPR/Cas9-edited Dictyostelium strains to study fslM-1 knockout phenotypes .

    • Leverage cryo-EM to resolve full-length structure and activation dynamics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be established during production. If you have a preferred tag type, please communicate it to us, and we will prioritize developing it for your order.
Synonyms
fslM-1; DDB_G0273035; fslM-2; DDB_G0274033; Frizzled and smoothened-like protein M
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-623
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslM-1
Target Protein Sequence
QTIYPIDPSGKCEQYIGDTPSSPCSKFLNNLDSIYVSSNATQQNAMKKLDEYFGILGAIG TSGCKSDSLTYKTLCSIYLPGCESFTNNQTNITIAIPKRICYNTCNNVTTKCGVPKFYFS CDQIEPVSGLPMFPLNYSEFNLTNYDVGNPNYTVQCYGPLSDNTMVNLDSSYCPPPLFYH NSTDHDADYDRGYLFVSETSNCVVPNPVPLYTNEQWDQLYNLSNTLAVLSTFGSLYLLVT FIILNPKVTSFDRMYGFFNGSVFMMSLSGVILFIAGGPRALIKDGGARISVFEDPLCSST GFIFQLFAINAILFWAYMGFDLWWRVKYITKPLNIQKYYVPIAFTISFIFSVIPLATKNY RMVRGNIHCWVHKAVLQNTLFFGPLGLTLTISTGFIGLVIYEIYKIVKATGRGGIMKLEI KPILNIVLIYFSFVYIFAFNFHNDNNSKNTYGSIDEFFQCTLESDDPSKCTVGGPSIGSL GYFIYCIRIYGIYCFFLQGLNERAFKIWKRSIVFNNRFILFIKVKLFSMDNNSPSESGNS STTAGTSTTINNSNINKKNNNSKPTLSTMDSNAFSKNNDSDSDFDDYDPYHKKQNDIEIG SVNIK
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a model organism?

Dictyostelium discoideum is a cellular slime mold widely used as a model organism in cell and developmental biology research. Its value stems from several key characteristics:

  • Simple life cycle with both unicellular and multicellular phases

  • Ease of laboratory cultivation and manipulation

  • Fully sequenced, low-redundancy genome

  • Haploid genome allowing straightforward gene disruption studies

  • 24-hour multicellular developmental phase with distinct stages

  • Maintenance of many genes and signaling pathways found in complex eukaryotes

The organism transitions from single-celled amoebae that feed on bacteria to a multicellular stage when starved, eventually producing a stalked fruiting body with viable spores . This developmental process shares features with metazoan development but occurs in a significantly shorter timeframe, allowing rapid detection of developmental phenotypes . These characteristics make Dictyostelium particularly useful for studying cell movement, chemotaxis, differentiation, autophagy, and host-pathogen interactions .

What expression systems are suitable for producing recombinant Dictyostelium discoideum proteins?

Several expression systems can be utilized for producing recombinant Dictyostelium proteins, each with specific advantages:

E. coli Expression System

  • Most commonly used for recombinant fslM-1 protein production

  • Typically yields His-tagged proteins for simplified purification

  • Efficiently expresses full-length mature protein (positions 19-623)

  • Advantages: high yield, cost-effective, scalable

  • Limitations: may lack post-translational modifications present in native protein

Dictyostelium discoideum as Expression Host

  • Allows for homologous expression with native post-translational modifications

  • Can secrete recombinant proteins efficiently (up to 20 mg/L for some proteins)

  • Expression remains stable for at least 100 generations without selection pressure

  • Correctly processes secretion signal peptides

  • Peptone-based growth medium supports efficient expression

Secreted protein yields from Dictyostelium expression system:

Recombinant ProteinYield after PurificationSource
PsA (D. discoideum glycoprotein)Up to 20 mg/L
GST (from S. japonicum)Up to 1 mg/L
GUS (from E. coli)Cell-associated (not secreted)

For membrane proteins like fslM-1, appropriate detergent selection is critical during purification to maintain proper folding and function .

What purification strategies are most effective for recombinant fslM-1 protein?

Effective purification of recombinant fslM-1 typically involves:

  • Affinity Chromatography: His-tagged fslM-1 can be purified using nickel or cobalt affinity resins

    • Buffer composition typically includes Tris-based buffers with pH 8.0

    • Addition of 6% trehalose enhances stability during purification and storage

  • Storage Considerations:

    • Recommended storage in aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL concentration

    • Addition of 5-50% glycerol (typically 50%) for long-term storage stability

  • Quality Control:

    • SDS-PAGE analysis to confirm purity (>90% purity is standard)

    • Mass spectrometry for sequence verification

    • Functional assays depending on research application

Purified protein should be handled with care to prevent aggregation, with working aliquots stored at 4°C for up to one week .

How can fslM-1 contribute to understanding signaling pathways in Dictyostelium discoideum?

As a Frizzled and smoothened-like protein, fslM-1 may contribute significantly to understanding developmentally relevant signaling pathways:

  • Potential Role in Wnt-like Signaling:

    • Frizzled proteins typically function as Wnt receptors in other organisms

    • Dictyostelium lacks canonical Wnt ligands but possesses Wnt signaling components

    • fslM-1 may participate in non-canonical Wnt-like pathways during development

    • Investigation methods include:

      • Genetic knockout/knockdown studies

      • Protein interaction analyses using immunoprecipitation followed by mass spectrometry

      • Localization studies during different developmental stages

  • Developmental Regulation:

    • Dictyostelium developmental progression involves differentiation-inducing factors (DIFs)

    • DIFs are chlorinated alkylphenones that induce stalk-cell differentiation at nanomolar levels

    • Research could investigate potential interactions between DIF signaling and fslM-1 function

    • DIFs have multiple biological activities in Dictyostelium and mammalian cells, including:

      • Modulation of chemotactic cell movement

      • Induction of cell differentiation

      • Regulation of programmed cell death

  • Methodological Approaches:

    • Generation of knockout mutants using CRISPR-Cas9 or homologous recombination

    • Creation of fluorescently tagged fslM-1 to track subcellular localization

    • Development of fslM-1-specific antibodies for immunofluorescence and western blotting

    • Application of bacterial selection methods for genetic manipulation of wild-type and axenic strains

What structural features of fslM-1 are important for its function?

Analysis of fslM-1's structural features reveals important functional domains:

  • Transmembrane Domains:

    • The protein contains multiple transmembrane segments characteristic of G-protein coupled receptors

    • The predicted structure from AlphaFold (pLDDT score: 87.39) indicates a confident structural model

    • Transmembrane regions likely include amino acids in positions where hydrophobic residues predominate

  • Extracellular Cysteine-Rich Domain (CRD):

    • Present in the N-terminal region (approximately positions 19-200)

    • Contains several cysteine residues that likely form disulfide bonds critical for proper folding

    • This domain typically mediates ligand binding in Frizzled receptors

  • Functional Motifs:

    • Potential phosphorylation sites in the C-terminal region (positions 550-623)

    • Conserved residues across the Frizzled family that may be critical for signal transduction

    • Regions corresponding to the intracellular loops may mediate interactions with downstream signaling proteins

Experimental approaches to study these structural features include:

  • Site-directed mutagenesis of key residues

  • Truncation analysis to define minimal functional domains

  • Cross-linking studies to identify interaction partners

  • Molecular dynamics simulations based on the AlphaFold model

What are the key considerations when designing experiments with recombinant fslM-1?

When designing experiments with recombinant fslM-1, researchers should consider:

  • Protein Stability:

    • Store lyophilized protein properly; avoid repeated freeze-thaw cycles

    • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 for optimal stability

    • For reconstitution, use deionized sterile water to achieve 0.1-1.0 mg/mL concentration

    • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Controls for Functional Assays:

    • Include positive controls with known activity

    • Use structurally related proteins from other species as comparative controls

    • Include appropriate negative controls (buffer-only or irrelevant protein)

  • Experimental Validation:

    • Confirm protein integrity before experiments via SDS-PAGE

    • Verify proper folding through circular dichroism or limited proteolysis

    • Consider the impact of tags (His-tag) on protein function

    • Design experiments to address potential detergent interference if working with membrane preparations

  • Reproducibility Considerations:

    • Document all experimental conditions meticulously

    • Be aware of potential strain variations in Dictyostelium discoideum stocks

    • Laboratory stocks of Dictyostelium commonly contain duplications and other genetic variations

    • Use consistent growth and development conditions for in vivo studies

How can antibodies against fslM-1 be developed and validated?

Development and validation of antibodies against fslM-1 requires careful consideration:

  • Antibody Development Strategies:

    • Recombinant antibody technology using phage display libraries

    • Hybridoma sequencing for developing monoclonal antibodies

    • Conversion of conventional antibodies to recombinant formats (scFv-Fc) for improved reliability

  • Validation Methods:

    • Western blotting to confirm specificity and appropriate molecular weight

    • Immunofluorescence to verify subcellular localization

    • Comparison with tagged versions of the protein (GFP-fslM-1)

    • Testing in knockout/knockdown cells as negative controls

  • Methodological Protocol for Immunofluorescence:

    • Fix 5 × 10^5 Dictyostelium cells with 4% paraformaldehyde for 30 min

    • Block with PBS + 40 mM ammonium chloride for 5 min

    • Permeabilize in cold methanol (-20°C) for 2 min

    • Wash with PBS and incubate in PBS + 0.2% BSA for 15 min

    • Incubate with primary antibody (e.g., scFv-Fc against fslM-1) for 30 min

    • Wash 3 times with PBS-BSA

    • Incubate with secondary antibody (e.g., anti-rabbit IgG-AlexaFluor-647) for 30 min

    • Wash and mount with Möwiol + 2.5% DABCO

    • Image using confocal microscopy

  • Recombinant Antibody Advantages:

    • Permanent storage as DNA sequence information

    • Flexibility in production systems (bacteria, fungi, mammalian cells)

    • Can be produced with various tags or Fc regions

    • Overcomes hybridoma stability issues

How does fslM-1 compare to similar proteins in other model organisms?

Comparative analysis of fslM-1 with similar proteins reveals important evolutionary and functional insights:

  • Evolutionary Context:

    • Frizzled proteins are evolutionarily conserved across eukaryotes

    • Dictyostelium discoideum diverged early in evolution, providing insight into ancestral functions

    • Comparison with frizzled proteins from metazoans helps identify core functional domains

  • Structural Comparisons:

    • Frizzled proteins in mammals typically function as Wnt receptors in development and disease

    • Smoothened proteins participate in Hedgehog signaling pathways

    • fslM-1 combines features of both protein families, suggesting potentially unique functions

    • Sequence conservation is typically highest in the transmembrane domains and cysteine-rich domain

  • Functional Implications:

    • Unlike mammalian systems, Dictyostelium lacks canonical Wnt ligands

    • fslM-1 may interact with novel ligands unique to Dictyostelium

    • The signaling cascade downstream of fslM-1 may represent an ancestral pathway that evolved into distinct Wnt and Hedgehog pathways in metazoans

  • Research Context:

    • Understanding fslM-1 provides insight into the evolution of developmental signaling pathways

    • May reveal fundamental mechanisms that have been conserved or modified through evolution

    • Contributes to the broader understanding of G-protein coupled receptor signaling mechanisms

What are the potential pharmaceutical applications of research on Dictyostelium discoideum proteins?

Research on Dictyostelium proteins has revealed significant pharmaceutical potential:

  • Differentiation-Inducing Factors (DIFs):

    • DIF-1, a chlorinated polyketide from Dictyostelium, exhibits promising antitumor activity

    • Functions as an inducer of stalk-cell differentiation at nanomolar levels

    • DIF-1 and derivatives show various biological activities with potential drug applications:

      • Anti-proliferative effects on various mammalian tumor cell lines

      • Induction of cell differentiation in human leukemia cells

      • Promotion of glucose uptake through GLUT1 translocation

      • Anti-diabetic activities

      • Immunoregulatory effects on IL-2 production in T cells

      • Anti-bacterial and anti-malarial properties

  • Polyketide Research Context:

    • Dictyostelium discoideum has approximately 43 polyketide synthase genes

    • Dictyostelium purpureum contains 50 predicted polyketide synthase genes

    • This exceeds the number in Streptomyces avermitilis, a bacterium known for producing secondary metabolites

    • Suggests Dictyostelium as an untapped source of novel lead compounds

  • fslM-1 Pharmaceutical Relevance:

    • As a GPCR-like protein, fslM-1 belongs to a protein family that represents the largest class of drug targets

    • Understanding its structure and function could inform development of novel therapeutics

    • May represent an ancestral version of important signaling pathways targeted in human disease

  • Methodological Framework:

    • Dictyostelium serves as an efficient expression system for recombinant proteins

    • Up to 20 mg/L of secreted recombinant proteins can be obtained

    • Correct processing of secretion signal peptides occurs in this system

    • Expression stability maintained for at least 100 generations without selection

What emerging techniques could advance research on fslM-1 and related proteins?

Several emerging techniques show promise for advancing fslM-1 research:

  • CRISPR-Cas9 Gene Editing:

    • Precise manipulation of the fslM-1 gene in Dictyostelium

    • Creation of domain-specific mutations to probe function

    • Generation of fluorescent protein fusions at endogenous loci

    • Bacterial growth selection methods for both wild-type and axenic strains

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize protein localization at nanoscale resolution

    • Single-molecule tracking to monitor fslM-1 dynamics in living cells

    • FRET-based biosensors to detect conformational changes and activation

    • Correlative light and electron microscopy to connect molecular and ultrastructural information

  • Structural Biology Approaches:

    • Cryo-electron microscopy for detailed structural analysis

    • Integration of AlphaFold predictions with experimental structural data

    • Hydrogen-deuterium exchange mass spectrometry to map ligand binding sites and conformational changes

    • Molecular dynamics simulations to understand ligand interactions and activation mechanisms

  • Systems Biology Integration:

    • Multi-omics approaches combining proteomics, transcriptomics, and metabolomics

    • Network analysis to position fslM-1 within broader signaling landscapes

    • Computational modeling of signaling dynamics

    • Comparative analyses across evolutionary diverse organisms

How can genetic variation in laboratory strains impact research on Dictyostelium proteins?

Genetic variation in laboratory strains represents a critical consideration for Dictyostelium researchers:

  • Documented Strain Variations:

    • Widespread duplications (15 kb or more) are common in laboratory stocks of Dictyostelium

    • Axenic strains (Ax2, Ax3, Ax4) contain specific duplications not present in the original NC4 strain

    • 9 out of 11 examined axenic strains possessed additional duplications beyond the known ones

    • These variations can significantly impact phenotypes and gene expression

  • Specific Examples of Variation:

    • Ax3/4 strains share a known chromosome 2 duplication

    • Ax2 strains contain a small (~26 kb) duplication/amplification on chromosome 1

    • The Ax2 amplification includes three protein kinases, a formin, and a potential transcription factor

  • Methodological Implications:

    • Always document the exact strain used in experiments

    • Consider validating key findings in multiple strain backgrounds

    • Be aware that "same" strains from different laboratories may have diverged genetically

    • Sequence verification may be necessary for critical genes of interest

  • Recommended Practices:

    • Maintain careful records of strain lineages

    • Consider using genome-wide methods (array CGH, sequencing) to characterize laboratory strains

    • When possible, validate findings in the original NC4 strain or other wild isolates

    • Establish standardized growth and maintenance conditions to minimize selection for new variants

This genetic variability underscores the importance of careful experimental design and strain selection when studying Dictyostelium proteins like fslM-1.

What are the most promising research avenues for fslM-1?

Based on current knowledge, the most promising research avenues for fslM-1 include:

  • Functional Characterization:

    • Identification of natural ligands or binding partners

    • Determination of its role in Dictyostelium development and chemotaxis

    • Investigation of potential interactions with differentiation-inducing factors (DIFs)

    • Elucidation of downstream signaling components

  • Structural Biology:

    • Experimental validation of the AlphaFold structural model

    • Determination of ligand binding mechanisms

    • Investigation of conformational changes during activation

    • Structure-guided design of modulators for functional studies

  • Evolutionary Biology:

    • Comparative analysis with frizzled and smoothened proteins across species

    • Investigation of fslM-1 as a potential evolutionary intermediate

    • Identification of conserved signaling mechanisms

    • Understanding how Wnt and Hedgehog pathways may have evolved from ancestral systems

  • Biotechnological Applications:

    • Development of fslM-1 as a potential target for high-throughput screening

    • Exploration of fslM-1 modulators as leads for drug discovery

    • Application of knowledge gained to human frizzled and smoothened proteins

    • Integration into broader understanding of GPCR biology for pharmaceutical applications

What resources and collaborations would benefit researchers working with fslM-1?

Researchers working with fslM-1 would benefit from:

  • Community Resources:

    • Shared antibody resources and validation data

    • Standardized protocols for expression and purification

    • Carefully documented strain repositories

    • Open access to structural models and experimental data

  • Interdisciplinary Collaborations:

    • Partnerships between developmental biologists and structural biologists

    • Integration of evolutionary perspectives through collaboration with phylogeneticists

    • Engagement with pharmacologists to explore potential therapeutic applications

    • Collaboration with computational biologists for pathway modeling

  • Technological Platforms:

    • Access to advanced imaging facilities

    • High-throughput screening capabilities

    • Structural biology infrastructure (cryo-EM, crystallography)

    • Computational resources for molecular dynamics simulations

  • Methodological Developments:

    • Improved genetic manipulation techniques for Dictyostelium

    • Enhanced expression systems for membrane proteins

    • Development of functional assays specific to fslM-1

    • Creation of bioinformatic tools for analyzing signaling pathways in this model organism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.