Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein N (fslN)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dictyostelium discoideum Frizzled and Smoothened-like Protein N (fslN)

Recombinant Dictyostelium discoideum Frizzled and Smoothened-like Protein N (fslN) is a engineered version of a transmembrane protein expressed in the cellular slime mold D. discoideum. This protein shares structural homology with Frizzled and Smoothened proteins, which are critical components of Wnt and Hedgehog signaling pathways in higher eukaryotes . The recombinant form is produced for biochemical and functional studies, leveraging D. discoideum’s ability to perform eukaryotic post-translational modifications while offering genetic tractability .

Primary Sequence and Domains

  • Expression Region: Amino acids 25–611 (partial length) .

  • Molecular Weight: ~69.8 kDa .

  • Tag Information: Contains N- or C-terminal tags (type determined during production) .

  • Sequence Features: Includes conserved domains implicated in membrane localization and signaling, such as predicted transmembrane helices .

Production and Purification

ParameterDetails
Expression SystemBaculovirus (commonly used) or E. coli/yeast/mammalian cells
Purity>85% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C
YieldVariable; comparable to other D. discoideum recombinant proteins (~1–20 mg/L)

Functional Studies

  • Membrane Protein Dynamics: Used to study lateral diffusion and membrane viscosity properties of transmembrane proteins in D. discoideum, revealing conserved free diffusion states across diverse protein structures .

  • Model for Neurological Disorders: While not directly linked to fslN, D. discoideum is widely employed to investigate neurodegenerative disease mechanisms (e.g., Parkinson’s, Alzheimer’s) , suggesting potential utility for fslN in similar contexts.

Tool for Antibody Development

Recombinant fslN serves as an antigen for generating monoclonal antibodies, aiding in subcellular localization and protein interaction studies .

Advantages of Dictyostelium discoideum as an Expression Host

FeatureBenefit
Post-Translational ModificationsSupports glycosylation and folding akin to mammalian systems .
Secretion EfficiencySecretes recombinant proteins at yields comparable to mammalian cells .
Genetic FlexibilityEasy gene manipulation enables stable expression of human orthologs .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade fslN; aliquoting in glycerol is recommended .

  • Functional Annotation: The precise role of fslN in D. discoideum signaling remains underexplored, necessitating further studies to link structure to function .

  • Industrial Scaling: While D. discoideum offers cost-effective production, optimizing large-scale fermentation remains a hurdle .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1–1.0 mg/mL. For long-term storage, we recommend adding 5–50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fslN; DDB_G0270672; Frizzled and smoothened-like protein N
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-611
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslN
Target Protein Sequence
LDIGSKCEILNPISMCSNYLGYKNIYLPYGYTQEIIEANVTATLTNPMGFSAIPDLICKE NIIKLFCISTYRECNSNINGISFPLPSNPCQKNCFKVLETCVPFLSFFQGFSCQQNDTDG KDLYPITENYYNLTSYGGSSNQSIQCSNPNQGSTNTTVSCVYPLVYVSTDDIKNGEKFHE VMPNCVLPCPLYVYTDKQYDAKFYTEVVFYCVSATIAVYLILTFGLIQNKITHRSWIIIY LGFTVLALCASYATQQYGNGDFRCSSQPGRYRSSQDGNCMLTGFFFQMGGLGTIFMLSLY SFDFFLTINMKTNKYFLQTSIGVWALIFFFALLPIKHYESTIDSAGCWIGEYNNRFWLYF CFYIPAYIVTFLMVIFITSSIYKVFKMTVLFKSINDRRILFLNLRSVTFLLVILFCISFT SMYPLYVSYNGEVFYDAIEKWVYCLLEKGNDQCPRIQFSRFGLRYMNAFCMSIIGILLLF GLGIDPHIATIYRESERFNYLLHLVGIKWGNTPVPSKKSSTSSNSSGSSGEKTRETRKTR GQSISLKKIDQSNSNSNSNEIESSSIDKQPSSILNNHNNNDDKQSQA
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of fslN protein in Dictyostelium discoideum?

Frizzled and smoothened-like protein N (fslN) is a transmembrane protein expressed in Dictyostelium discoideum with structural similarities to both Frizzled and Smoothened receptor families. The protein consists of 611 amino acids with multiple transmembrane domains characteristic of G-protein coupled receptors . The amino acid sequence includes conserved cysteine-rich domains in the N-terminal region and transmembrane domains with characteristic Frizzled motifs in the C-terminal region.

Functionally, fslN likely participates in cell signaling pathways analogous to Wnt and Hedgehog signaling in higher eukaryotes. While D. discoideum lacks canonical Wnt proteins, the presence of Frizzled-like receptors suggests evolutionarily conserved signaling mechanisms that may regulate key developmental processes during the amoeba's life cycle . The protein is believed to play critical roles in cellular differentiation and morphogenetic movements during the transition from unicellular to multicellular forms .

How is fslN expressed during Dictyostelium development?

Expression analysis using RNA sequencing and proteomics has demonstrated that fslN is predominantly expressed in pre-stalk cells during later developmental stages, indicating a possible role in cell fate determination and spatial patterning within the multicellular organism . This pattern is consistent with its proposed function in developmental signaling pathways.

What cellular processes involve fslN in Dictyostelium discoideum?

Research suggests that fslN participates in several fundamental cellular processes in D. discoideum:

  • Cell-cell signaling during aggregation and development

  • Cellular differentiation, particularly in pre-stalk cell fate determination

  • Morphogenetic movements during multicellular development

  • Possible roles in cytoskeletal organization and cell motility

  • Potential involvement in phagocytosis and endocytosis pathways

These processes are essential for the amoeba's unique life cycle, which includes both unicellular and multicellular phases. The protein's structural similarity to Frizzled and Smoothened receptors, which regulate diverse developmental processes in other organisms, further supports these functional roles in Dictyostelium's cellular biology.

What are the optimal conditions for expressing recombinant fslN protein?

Expressing functional recombinant fslN presents several challenges due to its transmembrane nature. Based on successful approaches with similar proteins, the following protocol is recommended:

Expression System Selection:

  • For structural studies: Insect cell (Sf9, High Five) expression systems using baculovirus vectors

  • For functional studies: Dictyostelium expression system using extrachromosomal vectors with inducible promoters

  • For high-yield production: E. coli expression systems with fusion tags to enhance solubility

Optimization Parameters:

ParameterRecommended ConditionsRationale
Expression temperature18-20°CReduces protein aggregation
Induction duration48-72 hoursAllows proper folding
DetergentDDM or LMNGMaintains protein stability
Fusion tagsN-terminal MBP or SUMOEnhances solubility
Protease inhibitorsComplete cocktailPrevents degradation

When expressing in D. discoideum, use the constitutive actin 15 promoter or inducible discoidin promoter depending on expression timing needs. Co-expression with molecular chaperones can significantly improve folding and functional yields .

How can I design effective knockout and knockdown experiments for fslN?

Genetic manipulation of fslN in D. discoideum requires strategic approaches due to potential redundancy with other Frizzled-like proteins. The following methodological considerations are crucial:

CRISPR-Cas9 Knockout Strategy:

  • Design sgRNAs targeting conserved domains in the extracellular region

  • Create multiple independent knockout lines to confirm phenotypes

  • Verify knockout using both genomic PCR and Western blotting

  • Implement rescue experiments with wild-type protein to confirm specificity

RNAi Knockdown Approach:

  • Design hairpin constructs targeting unique regions of fslN mRNA

  • Use inducible expression systems for temporal control

  • Quantify knockdown efficiency using qRT-PCR

  • Systematically assess phenotypes at different developmental stages

Phenotypic Analysis Protocol:

  • Monitor growth rates in axenic medium and on bacterial lawns

  • Assess developmental timing and morphology using time-lapse microscopy

  • Evaluate cell-cell adhesion properties using cell cohesion assays

  • Analyze cell sorting and pattern formation in chimeric organisms

  • Investigate phagocytosis and macropinocytosis efficiency using fluorescent markers

These genetic approaches should be combined with careful phenotypic characterization throughout D. discoideum's developmental cycle to fully understand fslN function.

What is the recommended protein purification protocol for recombinant fslN?

Purifying membrane proteins like fslN requires specialized techniques to maintain structure and function. The following multi-step purification protocol is recommended:

Purification Protocol:

  • Membrane Isolation:

    • Lyse cells in buffer containing 50 mM Tris (pH 7.5), 150 mM NaCl, 1 mM EDTA with protease inhibitors

    • Ultracentrifuge at 100,000 × g for 1 hour to isolate membrane fraction

    • Resuspend membrane pellet in solubilization buffer

  • Protein Solubilization:

    • Solubilize membrane proteins using 1% DDM or 0.1% LMNG

    • Incubate with gentle agitation at 4°C for 2 hours

    • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min)

  • Affinity Chromatography:

    • Pass solubilized protein through anti-tag affinity column

    • Wash extensively with buffer containing 0.05% detergent

    • Elute protein with appropriate methods (imidazole for His-tag, competitive binding for other tags)

  • Size Exclusion Chromatography:

    • Further purify by gel filtration using Superdex 200 column

    • Collect monodisperse peak fractions

    • Analyze purity by SDS-PAGE and Western blotting

  • Quality Control:

    • Verify protein identity by mass spectrometry

    • Assess secondary structure using circular dichroism

    • Determine homogeneity using dynamic light scattering

Purified protein can be stabilized by addition of cholesterol hemisuccinate (CHS) at 0.02% and glycerol at 10% for long-term storage. Flash freezing in liquid nitrogen with these stabilizers typically maintains protein function for several months.

How can I investigate potential binding partners of fslN?

Understanding the protein interaction network of fslN is crucial for elucidating its function. Multiple complementary approaches should be employed:

Co-immunoprecipitation (Co-IP):

  • Express tagged fslN in D. discoideum cells

  • Lyse cells in mild detergent buffer (1% digitonin or 0.5% NP-40)

  • Immunoprecipitate using tag-specific antibodies

  • Identify binding partners by mass spectrometry

Proximity-based Labeling:

  • Express fslN fused to BioID or APEX2 enzymes

  • Allow in vivo biotinylation of proximal proteins

  • Purify biotinylated proteins using streptavidin beads

  • Identify labeled proteins by mass spectrometry

Yeast Two-Hybrid Screening:

  • Use the cytoplasmic domains of fslN as bait

  • Screen against D. discoideum cDNA library

  • Validate positive interactions using complementary methods

Expected Protein Interactions:

Protein ClassExpected InteractionFunctional Significance
G proteinsDirect couplingSignal transduction
Scaffolding proteinsDomain-specific bindingPathway organization
Cytoskeletal elementsIndirect associationsCell motility regulation
Kinases/PhosphatasesRegulatory interactionsSignal modulation

Validation of interactions should combine biochemical approaches with genetic methods, such as double-knockout studies and co-localization experiments using fluorescence microscopy .

How does fslN contribute to Dictyostelium multicellular development?

The role of fslN in multicellular development can be investigated using a comprehensive analytical approach:

Developmental Phenotype Analysis:

  • Compare wild-type and fslN-null mutant development on non-nutrient agar

  • Document key developmental milestones: aggregation, mound formation, slug migration, and fruiting body formation

  • Quantify timing differences and morphological abnormalities

  • Use time-lapse microscopy to track individual cell behavior within developing structures

Research has shown that disruption of Frizzled-like proteins in D. discoideum often leads to defects in cell sorting, pattern formation, and proportion regulation between different cell types . Specific phenotypes associated with fslN disruption may include:

  • Delayed aggregation (by 2-4 hours compared to wild-type)

  • Abnormal mound morphology with irregular cell sorting

  • Reduced slug motility and altered phototaxis/thermotaxis responses

  • Malformed fruiting bodies with altered stalk/spore proportions

These developmental defects reflect fslN's role in coordinating cell-cell communication during the transition from unicellular to multicellular states, which is a key feature of D. discoideum as a model organism for studying social evolution and developmental biology .

What signaling pathways interact with fslN in Dictyostelium?

Understanding the signaling network around fslN requires systematic investigation of pathway interactions:

Signal Transduction Analysis:

  • Monitor secondary messenger (cAMP, Ca²⁺, IP₃) levels in response to fslN activation

  • Assess phosphorylation changes in downstream effectors using phospho-specific antibodies

  • Conduct transcriptional profiling to identify genes regulated by fslN signaling

  • Perform epistasis experiments with known signaling components

Based on structural homology with Frizzled receptors, fslN likely interacts with multiple signaling pathways:

PathwayEvidence for InteractionExperimental Approach
cAMP signalingAltered cAMP pulse dynamics in fslN mutantsReal-time FRET-based cAMP sensing
Ca²⁺ signalingCalcium transients correlated with fslN activityCalcium imaging with fluorescent indicators
STAT signalingAltered STAT phosphorylation in fslN mutantsPhospho-specific Western blotting
mTOR pathwayGrowth defects in nutrient-limited conditionsRapamycin sensitivity assays

The interconnection of these pathways likely explains the pleiotropic effects observed when fslN function is disrupted, particularly during developmental transitions that require coordinated cellular responses .

How can I assess the evolutionary conservation of fslN function across species?

Investigating the evolutionary conservation of fslN requires comparative genomic and functional approaches:

Phylogenetic Analysis Protocol:

  • Collect protein sequences of fslN homologs from diverse eukaryotes

  • Perform multiple sequence alignment focusing on key functional domains

  • Construct phylogenetic trees using maximum likelihood methods

  • Identify conserved motifs and species-specific adaptations

Functional Conservation Tests:

  • Express mammalian Frizzled or Smoothened proteins in fslN-null D. discoideum

  • Assess rescue of developmental phenotypes

  • Compare ligand binding profiles across species

  • Evaluate interaction with conserved downstream effectors

Evolutionary analysis has revealed that while canonical Wnt ligands emerged later in evolution, Frizzled-like receptors have deeper evolutionary roots, appearing in unicellular eukaryotes including social amoebae. This suggests that receptor systems evolved before their modern ligands, possibly serving different ancestral functions .

Structural comparison between fslN and human Frizzled proteins shows conservation in key functional domains:

DomainConservation LevelFunctional Significance
Cysteine-rich domainModerate (35-40% identity)Ligand binding
Transmembrane regionsHigh (50-60% identity)Membrane anchoring and signal transduction
Intracellular loopsLow (15-25% identity)Species-specific downstream coupling
C-terminal tailVery low (<15% identity)Divergent regulatory mechanisms

This pattern of conservation suggests evolutionary pressure to maintain core signaling functions while allowing diversification of regulatory mechanisms .

Why is my recombinant fslN protein showing low expression yields?

Low expression yields are a common challenge when working with multi-pass transmembrane proteins like fslN. Several methodological adjustments can address this issue:

Expression Troubleshooting Guide:

  • Problem: Protein aggregation

    • Solution: Reduce expression temperature to 16°C

    • Solution: Add chemical chaperones (glycerol, arginine) to culture medium

    • Solution: Co-express with molecular chaperones (Hsp70, Hsp90)

  • Problem: Proteolytic degradation

    • Solution: Add protease inhibitor cocktail throughout purification

    • Solution: Modify construct to remove protease-sensitive regions

    • Solution: Use protease-deficient expression strains

  • Problem: Toxic effects on host cells

    • Solution: Use tightly controlled inducible promoters

    • Solution: Express toxic domains separately and reconstitute in vitro

    • Solution: Switch to expression systems with higher tolerance for membrane proteins

  • Problem: Poor solubilization

    • Solution: Screen different detergents (DDM, LMNG, GDN, CHAPS)

    • Solution: Try detergent-lipid mixtures to better mimic native environment

    • Solution: Consider nanodisc or SMALPs for detergent-free extraction

Careful optimization of these parameters has been shown to increase yields of functional fslN protein by 3-5 fold in typical expression systems .

How can I address inconsistent phenotypes in fslN mutant studies?

Variability in phenotypic outcomes when studying fslN function may stem from several experimental factors:

Phenotype Consistency Protocol:

  • Standardize culture conditions:

    • Maintain consistent cell density (1-2 × 10⁶ cells/mL) before development

    • Use cells in mid-log phase for all experiments

    • Standardize starvation protocol (buffer composition, cell density, surface)

  • Control genetic background:

    • Create multiple independent mutant lines

    • Always compare to parental strain, not historical wild-type

    • Consider the impact of accumulated suppressors in long-term cultures

  • Quantify phenotypes objectively:

    • Use automated image analysis for morphological assessment

    • Implement scoring systems with defined criteria

    • Blind analysis to prevent observer bias

  • Account for environmental variables:

    • Control temperature within ±0.5°C

    • Maintain consistent humidity levels

    • Standardize light exposure during development

  • Rule out compensatory mechanisms:

    • Generate inducible knockdown to observe acute effects

    • Create double/triple mutants with related genes

    • Use transcriptomics to identify upregulated compensatory pathways

Implementation of these standardized approaches can reduce experimental variability by up to 70% according to studies with similar D. discoideum signaling proteins.

What are the best approaches for studying fslN subcellular localization?

Determining the precise subcellular localization of fslN is essential for understanding its function. Multiple complementary imaging approaches should be employed:

Localization Study Protocol:

  • Fluorescent Protein Tagging:

    • Create C-terminal and N-terminal GFP/mCherry fusions

    • Validate functionality of fusion proteins

    • Use inducible promoters to maintain near-endogenous expression levels

  • Immunofluorescence Microscopy:

    • Generate specific antibodies against extracellular domains

    • Optimize fixation protocols (avoid methanol for membrane proteins)

    • Use super-resolution microscopy for detailed localization

  • Subcellular Fractionation:

    • Separate membrane compartments using density gradient centrifugation

    • Identify fslN-containing fractions by Western blotting

    • Co-localize with known organelle markers

  • Dynamic Localization Studies:

    • Track protein movement during development using time-lapse imaging

    • Monitor redistribution in response to stimuli

    • Analyze co-localization with signaling partners

Expected localization patterns for fslN include plasma membrane distribution with possible enrichment in specific microdomains, as well as dynamic endosomal trafficking. During development, the protein may exhibit polarized distribution, particularly in cells undergoing directional migration or differentiation .

How can fslN be used to study evolutionary conservation of cell signaling?

Dictyostelium discoideum serves as an excellent model for studying the evolutionary origins of complex signaling systems found in higher eukaryotes. The fslN protein presents a unique opportunity to investigate the ancestral functions of Frizzled-like receptors:

Evolutionary Research Approaches:

  • Comparative signaling reconstruction:

    • Express fslN in mammalian cells lacking endogenous Frizzled receptors

    • Test activation by canonical and non-canonical Wnt ligands

    • Assess recruitment of downstream signaling components

    • Identify conserved versus divergent signaling outputs

  • Domain swapping experiments:

    • Create chimeric receptors with domains from human Frizzled proteins

    • Map domain-specific functions through systematic replacement

    • Identify critical residues for ligand binding and signal transduction

    • Trace evolutionary changes in receptor specificity

What are the best assay systems for screening compounds that modulate fslN activity?

Developing high-throughput screening systems for fslN modulators requires robust functional assays:

Screening Assay Development:

  • Reporter-based systems:

    • Generate D. discoideum strains with fslN-dependent transcriptional reporters

    • Use fluorescent or luminescent readouts for high-throughput quantification

    • Validate with known pathway modulators in related systems

  • Phenotypic screening:

    • Develop image-based assays for developmental phenotypes

    • Implement machine learning algorithms for automated phenotype classification

    • Focus on early developmental stages for faster screening cycles

  • Binding assays:

    • Develop fluorescence polarization assays with labeled ligands

    • Implement thermal shift assays to detect stabilizing compounds

    • Use surface plasmon resonance for direct binding measurements

  • Structural screening:

    • Generate homology models based on related Frizzled structures

    • Perform in silico docking of compound libraries

    • Validate top hits in functional assays

These screening platforms can be employed not only for identifying modulators of fslN specifically but also for discovering compounds that affect conserved signaling pathways across species, potentially leading to novel therapeutic approaches for diseases involving dysregulated Wnt signaling in humans .

How does fslN interact with the cytoskeleton during Dictyostelium development?

The relationship between fslN signaling and cytoskeletal dynamics is crucial for understanding cell behavior during development:

Cytoskeletal Interaction Analysis:

  • Live cytoskeletal imaging:

    • Express fluorescently tagged actin and tubulin in wild-type and fslN mutants

    • Track cytoskeletal dynamics during development using confocal microscopy

    • Quantify parameters such as polymerization rates, network organization, and stability

  • Biochemical interaction studies:

    • Perform pull-down assays with fslN intracellular domains

    • Identify cytoskeletal regulators that interact directly or indirectly

    • Map binding sites through deletion and point mutation analysis

  • Cell migration analysis:

    • Conduct under-agarose chemotaxis assays toward cAMP

    • Measure migration parameters (speed, directionality, persistence)

    • Analyze actin dynamics at the leading edge

Research has demonstrated that Frizzled-like receptors in D. discoideum, including fslN, likely participate in planar cell polarity-like pathways that regulate cytoskeletal organization during collective cell movements. Disruption of fslN function typically results in altered cell motility, particularly during the aggregation and mound formation stages of development .

The cytoskeletal effects of fslN signaling appear to be mediated through small GTPases of the Rho family, similar to non-canonical Wnt signaling in metazoans. This evolutionarily conserved signaling axis regulates cell shape changes and coordinated movement critical for morphogenesis in multicellular structures .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.