Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein P (fslP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dictyostelium discoideum Frizzled and Smoothened-like Protein P

Frizzled and smoothened-like protein P (fslP) is a transmembrane protein found in the social amoeba Dictyostelium discoideum, an important model organism in cellular and developmental biology research. The recombinant version of fslP refers to the protein that has been artificially produced using recombinant DNA technology in expression systems such as Escherichia coli. This approach allows for the production of significant quantities of purified protein for research purposes without the need to extract it directly from D. discoideum cells .

Recombinant fslP belongs to a family of proteins that share structural similarities with frizzled and smoothened proteins, which are known to function as receptors in important signaling pathways in many organisms. In D. discoideum, these proteins are likely involved in cellular communication, development, and response to environmental cues, making them valuable subjects for research in cell signaling and developmental biology.

Biological Context of fslP

Dictyostelium discoideum serves as a valuable model organism for studying various aspects of eukaryotic cell biology, including cell motility, cell adhesion, macropinocytosis, phagocytosis, host-pathogen interactions, and multicellular development . Within this context, frizzled and smoothened-like proteins, including fslP, potentially play significant roles in cellular signaling and developmental processes, although the specific functions of fslP are still being investigated.

Protein Modifications and Tags

The recombinant fslP is produced with an N-terminal His-tag, which consists of multiple histidine residues that facilitate purification through affinity chromatography . This tag allows researchers to selectively isolate the protein from the complex mixture of cellular components present after expression. The His-tag may be retained for research applications or removed through enzymatic cleavage, depending on the specific requirements of the experiments.

Expression and Purification of Recombinant fslP

The production of recombinant fslP involves sophisticated biotechnological processes that ensure high yield and purity of the final product. Understanding these processes is essential for researchers utilizing this protein in their studies.

Expression Systems and Methodology

Recombinant fslP is expressed in Escherichia coli, a prokaryotic expression system widely used for recombinant protein production due to its rapid growth, high protein yields, and well-established genetic manipulation techniques . The gene encoding fslP (DDB_G0286607) is cloned into an appropriate expression vector, which contains elements necessary for efficient transcription and translation in E. coli, including a strong promoter, ribosome binding site, and appropriate termination signals.

The expression construct typically includes sequences encoding the His-tag at the N-terminus of the protein, followed by the fslP sequence corresponding to amino acids 21-587 . This construct is transformed into an E. coli strain optimized for protein expression, and production is induced under controlled conditions to maximize yield and minimize the formation of inclusion bodies.

Purification Process and Quality Control

After expression, the bacterial cells are harvested and lysed to release the recombinant protein. The His-tagged fslP is purified through affinity chromatography using nickel or cobalt resins that selectively bind the His-tag . Following elution, additional purification steps may be employed, such as size exclusion chromatography or ion-exchange chromatography, to achieve high purity.

The quality of the purified protein is assessed through various analytical techniques, including:

  1. SDS-PAGE to confirm the molecular weight and purity (greater than 90% as determined by SDS-PAGE)

  2. Western blotting to verify the identity of the protein

  3. Mass spectrometry for precise molecular weight determination

  4. Functional assays to confirm biological activity if applicable

Physical and Biochemical Properties

Understanding the physical and biochemical properties of recombinant fslP is crucial for its proper handling and application in research settings.

Comparative Analysis with Other Frizzled and Smoothened-like Proteins

Dictyostelium discoideum possesses multiple frizzled and smoothened-like proteins, each with potentially distinct functions. Comparing fslP with other members of this family provides insights into their evolutionary relationships and functional specializations.

Structure and Sequence Comparison

When comparing fslP with other frizzled and smoothened-like proteins in D. discoideum, such as fslJ-1 and fslF, several similarities and differences become apparent. For instance, fslJ-1 (Q556J4) consists of 581 amino acids (positions 27-607) and also contains characteristic domains of the frizzled family . Similarly, fslF (Q54J77) spans positions 18-591 and shares structural features with fslP and fslJ-1 .

The amino acid sequences of these proteins show both conserved and variable regions, reflecting their common evolutionary origin and potentially specialized functions. All three proteins feature transmembrane domains characteristic of membrane receptors, suggesting roles in signal transduction across the cell membrane.

Functional Implications

While the specific functions of fslP, fslJ-1, and fslF in D. discoideum have not been fully elucidated, their structural similarities to frizzled and smoothened proteins in other organisms suggest potential roles in developmental signaling pathways. In many organisms, frizzled proteins function as receptors for Wnt ligands, while smoothened proteins participate in Hedgehog signaling, both critical pathways in development and cellular homeostasis.

The presence of multiple frizzled and smoothened-like proteins in D. discoideum indicates possible functional redundancy or specialization, potentially allowing the organism to respond to different environmental cues or developmental stages with specific signaling mechanisms.

Applications in Research

Recombinant fslP offers numerous applications in scientific research, from basic studies of protein structure and function to more complex investigations of cellular signaling and development.

Immunological Applications

Recombinant fslP serves as a valuable antigen for antibody production, enabling the development of specific antibodies for immunological studies. The availability of recombinant antibodies against D. discoideum antigens has been recognized as important for the scientific community studying this organism . These antibodies can be used for techniques such as Western blotting, immunoprecipitation, immunofluorescence, and immunohistochemistry to detect and localize fslP in cells and tissues.

Model Organism Research

Dictyostelium discoideum serves as a powerful model organism for studying various aspects of cell biology . The availability of recombinant D. discoideum proteins, including fslP, facilitates research on cellular processes such as cell motility, phagocytosis, and host-pathogen interactions. These studies can provide valuable insights into fundamental biological mechanisms with potential relevance to human health and disease.

Specific research applications include:

  1. Investigation of signaling pathways in D. discoideum development

  2. Studies of protein-protein interactions involving fslP

  3. Functional characterization through complementation experiments in mutant strains

  4. Comparative analyses with homologous proteins in other organisms

Practical Handling Guidelines

For optimal results when working with recombinant fslP, researchers should adhere to the following guidelines:

  1. Centrifuge the vial briefly before opening to bring contents to the bottom

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add 5-50% glycerol (final concentration) for long-term storage

  4. Store working aliquots at 4°C for up to one week

  5. Avoid repeated freeze-thaw cycles

  6. For long-term storage, keep at -20°C or -80°C

  7. Follow specific experimental protocols for the intended application

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific needs. Should you require a particular format, please specify this when placing your order and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it according to your request.
Synonyms
fslP; DDB_G0286607; Frizzled and smoothened-like protein P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-587
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslP
Target Protein Sequence
QDLKLGGSCELIDSNSPCFSKLNYTDFYLQPGDSITQLNKNVSDIIRMLEFTTPECKPNA INLICLKSYPKCETHNETLSNNTNIIFNLPSLPCNSICLIAETPCKIFIDNFLKDLSCSS KFSNGVPMFPINSTDFEFKESGNFDFNFNVECNDNIIYDNSSSVINCPAPLLNSKDHVIP GKTTYYYITDSCILDCPFEIYPGKTKILDKTNYTLTSISFITCFFMILTFGVLPNKITHR MESILSFACGGCITALSLFIQSRQDNFNCSSDPGRFKSQSDYLCLLTGLIFQFGAITSIF WAPMIAYDFYITSRLSKIRKFGLYRIGIWSLIFVLTALPAFGGKYSATVATSCWINSDDG SAWQYISFYIPSWCAMGLLCLFSILSVINVSKMYMKSPNRRILFFNIKIIITSLILLFNL TFASSLKFYMEDKMDTYFDAIAVWAECISKGDPSQCELHAPGYELKALNVVVVSILGFCI FIGYGLDPIVIQIWKESEKLKWILKKCGLNDFIKLGSETTSTTNTSGSSGSGSEKRQSKI RMSKLSPPPPSIDTTNDIPINDTLGEN
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a model organism for studying recombinant proteins?

Dictyostelium discoideum is a social amoeba increasingly used as a model for studying genes that in mutant form cause disease in humans. The completed genome sequence of D. discoideum, combined with its extensive repertoire of molecular genetic tools and intrinsic biological features, allows researchers to investigate many fundamental cellular processes . As a haploid organism, non-essential genes in D. discoideum can be easily disrupted or replaced by homologous recombination, making it ideal for genetic manipulation studies .

The model offers several distinct advantages for recombinant protein studies:

  • Simple cultivation requirements

  • Amenability to diverse biochemical and biological approaches

  • Capacity for in vivo expression of fluorescence-tagged proteins

  • Availability of a large mutant collection through the Dictyostelium stock center

  • Straightforward generation and analysis of mutant strains

These features collectively make D. discoideum an excellent system for expressing and studying recombinant proteins, including complex membrane proteins like fslP.

What genetic manipulation techniques are available for studying fslP in D. discoideum?

Dictyostelium discoideum offers a comprehensive toolkit for genetic manipulation to study proteins like fslP. These techniques include:

  • Gene disruption or replacement through homologous recombination

  • Random insertion mutagenesis (restriction-enzyme-mediated integration, REMI)

  • Multiple gene deletions

  • Cre/LoxP-mediated recombination

  • RNA interference techniques

  • Ectopic expression of endogenous or foreign genes

For efficient gene knockouts, vectors for one-step cloning are available . Additionally, an extensive library of plasmids allows for constitutive or inducible production of fluorescently labeled proteins in D. discoideum. These include:

  • Extrachromosomal plasmids

  • Extrachromosomal inducible expression vectors

  • Integrating plasmids

  • Vectors for N- or C-terminal fusions with green- or red-fluorescent proteins

Transformation of D. discoideum with these plasmids is typically performed by electroporation, with transformants being isolated by antibiotic selection within 7-12 days .

How can fluorescent tagging be applied to study fslP localization and function?

Fluorescent tagging is a powerful approach for studying protein localization and function in D. discoideum. For proteins like fslP, researchers can utilize the extensive library of plasmid vectors available for N- or C-terminal fusions with green or red fluorescent proteins .

Methodological approach:

  • Select an appropriate vector (extrachromosomal or integrating) for GFP-fslP or fslP-GFP fusion

  • Transform D. discoideum with the construct using electroporation

  • Isolate transformants through antibiotic selection (7-12 days post-transformation)

  • Confirm expression using fluorescence microscopy and/or Western blotting

For advanced applications, dual-labeling approaches can be employed. For example, D. discoideum cells can be transformed to produce both a fluorescently tagged fslP and a marker for specific cellular compartments. This approach has been successfully used for other proteins, where D. discoideum amoebae producing in tandem GFP-tagged proteins and markers like AmtA-mCherry were analyzed to determine protein localization .

Live-cell imaging can further reveal the dynamics of fslP localization during cellular processes. This technique has been successfully employed to assess various protein dynamics in D. discoideum producing fluorescently tagged proteins .

How can transcriptional analysis be used to understand fslP expression patterns in D. discoideum?

Transcriptional analysis provides valuable insights into the expression patterns and regulation of genes like fslP in D. discoideum. Based on established methodologies in D. discoideum research, the following approaches can be implemented:

Microarray analysis:
Previous studies have used cDNA-microarrays covering approximately half of the Dictyostelium genome to identify differentially regulated host genes under various conditions . For fslP, this approach could reveal:

  • Temporal expression patterns during development

  • Response to environmental stimuli

  • Co-regulated genes in the same pathway

RNA-Seq methodologies:
More advanced than microarrays, RNA-Seq can provide:

  • Absolute quantification of fslP expression levels

  • Identification of splice variants

  • Detection of novel transcripts related to fslP

Time-course expression analysis:
Similar to studies that examined transcriptional changes in D. discoideum upon infection with L. pneumophila, researchers can track fslP expression over time to understand its role in developmental processes or response to stimuli .

Time PointTechniqueData CollectedAnalysis Method
Vegetative growthRNA-SeqfslP expression levelsDifferential expression analysis
Early developmentRNA-SeqfslP and related genesPathway analysis
Mid developmentRNA-SeqPotential splice variantsIsoform detection
Late developmentRNA-SeqRegulatory elementsPromoter analysis

This comprehensive transcriptional analysis would provide a foundation for understanding when and where fslP functions in D. discoideum.

What approaches can be used to study protein-protein interactions of fslP in D. discoideum?

Understanding protein-protein interactions is crucial for elucidating the function of fslP in signaling pathways. Several complementary approaches can be employed in D. discoideum:

Co-immunoprecipitation with tagged fslP:

  • Express GFP-tagged fslP in D. discoideum

  • Lyse cells under conditions that preserve protein-protein interactions

  • Immunoprecipitate using GFP-Trap or anti-GFP antibodies

  • Identify interacting partners through mass spectrometry

Proximity-based labeling:
BioID or TurboID fused to fslP can be used to biotinylate proximal proteins, which can then be purified using streptavidin and identified by mass spectrometry.

Fluorescence resonance energy transfer (FRET):
This technique can detect direct protein-protein interactions in living cells by co-expressing fslP fused to a donor fluorophore and a candidate interacting protein fused to an acceptor fluorophore.

Yeast two-hybrid screening:
While not performed in D. discoideum directly, this approach can identify potential interacting partners that can then be validated in D. discoideum.

These approaches have been successfully applied for other proteins in D. discoideum. For example, studies have identified interactions between host proteins and bacterial effectors using fluorescently tagged proteins and microscopy-based approaches .

How do post-translational modifications affect fslP function and localization?

Post-translational modifications (PTMs) often play critical roles in regulating protein function, localization, and interactions. For transmembrane proteins like fslP, several approaches can be used to study PTMs:

Mass spectrometry-based PTM mapping:

  • Express and purify recombinant fslP from D. discoideum

  • Perform tryptic digestion followed by LC-MS/MS analysis

  • Use specialized software to identify PTMs (phosphorylation, glycosylation, etc.)

  • Validate key PTMs through site-directed mutagenesis

Phosphorylation analysis:
Similar to studies on phosphoinositide (PI) metabolism in D. discoideum, researchers can investigate how phosphorylation affects fslP function . This might involve:

  • Phospho-specific antibodies

  • Phosphatase treatments

  • Expression of phosphomimetic mutants

Glycosylation analysis:
For membrane proteins like fslP, N-linked and O-linked glycosylation may be important for proper folding and function:

  • Treat purified protein with glycosidases

  • Compare mobility shifts on SDS-PAGE

  • Use lectin binding assays to characterize glycan structures

Effect of PTMs on localization:
Using fluorescently tagged fslP variants with mutated PTM sites, researchers can observe changes in subcellular localization, similar to studies tracking protein dynamics in D. discoideum .

What are the optimal expression systems for producing recombinant fslP in D. discoideum?

Producing recombinant fslP in D. discoideum requires careful consideration of expression systems to ensure proper folding, modification, and functionality. Based on established methods in D. discoideum, researchers should consider:

Vector selection:
D. discoideum offers various expression vector options:

  • Extrachromosomal plasmids for transient expression

  • Extrachromosomal inducible expression vectors for controlled production

  • Integrating plasmids for stable expression

Promoter selection:

  • Constitutive promoters (actin15) for continuous expression

  • Inducible promoters (folate-inducible, tetracycline-regulated) for temporal control

Fusion tags optimization:
For membrane proteins like fslP, consider:

  • N-terminal vs. C-terminal tags based on topology prediction

  • Cleavable tags (TEV protease site) for tag removal

  • Affinity tags (His, FLAG, Strep) for purification

  • Fluorescent tags (GFP, mCherry) for localization studies

Expression conditions:

  • Temperature (typically 21-22°C)

  • Media composition (HL5 with appropriate supplements)

  • Growth phase (typically mid-log phase)

The table below summarizes recommended expression systems for recombinant fslP:

System ComponentRecommended OptionsConsiderations
Vector typeExtrachromosomal inducibleAllows control over expression timing
PromoterActin15 or discoidinStrong, constitutive expression
Affinity tagN-terminal His6 with GFPFacilitates purification and localization studies
Antibiotic selectionG418 (geneticin)Common selection for D. discoideum transformants
Cell density2-4 × 10^6 cells/mLOptimal density for protein production

What purification strategies are most effective for isolating recombinant fslP?

Purifying membrane proteins like fslP from D. discoideum presents unique challenges but can be achieved through specialized strategies:

Cell lysis optimization:

  • Harvest D. discoideum cells expressing recombinant fslP

  • Lyse cells using methods that preserve membrane protein integrity:

    • French press

    • Nitrogen cavitation

    • Gentle detergent lysis

  • Separate membrane fraction through ultracentrifugation (100,000 × g for 1 hour)

Detergent screening:
Test multiple detergents for solubilization efficiency and protein stability:

DetergentConcentrationAdvantagesLimitations
DDM1%Mild, preserves functionLess efficient extraction
LMNG0.5-1%Superior stabilityExpensive
Digitonin0.5-1%Preserves protein complexesLimited solubilization
SDS0.1-0.5%Efficient solubilizationDenaturing

Affinity chromatography:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged fslP

  • Anti-GFP affinity purification for GFP-fslP fusion proteins

  • Size exclusion chromatography for final polishing and buffer exchange

Quality assessment:

  • SDS-PAGE and Western blotting to confirm purity

  • Dynamic light scattering to assess homogeneity

  • Mass spectrometry to verify protein identity and modifications

These purification strategies build upon established protocols for membrane protein purification from D. discoideum, which have been used successfully for other complex proteins .

How can CRISPR-Cas9 gene editing be applied to study fslP function in D. discoideum?

While traditional homologous recombination has been the mainstay for genetic manipulation in D. discoideum, CRISPR-Cas9 technology offers new opportunities for precise gene editing to study fslP function:

CRISPR-Cas9 strategy for fslP modification:

  • Design sgRNAs targeting specific regions of the fslP gene

  • Clone sgRNAs into a D. discoideum-compatible Cas9 expression vector

  • Co-transform with a repair template containing desired modifications

  • Screen transformants for successful editing

Applications for fslP research:

  • Gene knockout: Complete deletion of fslP to assess loss-of-function phenotypes

  • Point mutations: Introduction of specific mutations to study critical residues

  • Domain deletions: Removal of specific domains to assess their contribution

  • Endogenous tagging: Adding tags to the endogenous locus for physiological expression levels

Validation methods:

  • PCR and sequencing to confirm genetic modifications

  • Western blotting to verify protein expression changes

  • Phenotypic assays to assess functional consequences

This approach builds upon the established genetic manipulation techniques in D. discoideum, where non-essential genes can be easily disrupted or replaced , but offers greater precision and efficiency.

What functional assays can be used to characterize recombinant fslP activity?

Characterizing the functional activity of recombinant fslP requires specialized assays that address its putative role in cellular signaling. Based on methodologies used for other signaling proteins in D. discoideum, researchers can implement:

Ligand binding assays:

  • Prepare membrane fractions or purified fslP

  • Incubate with labeled potential ligands

  • Measure binding through:

    • Fluorescence polarization

    • Surface plasmon resonance

    • Microscale thermophoresis

Cell-based signaling assays:

  • Calcium flux measurements using fluorescent calcium indicators

  • cAMP accumulation assays to detect G-protein coupled signaling

  • Phosphorylation cascade analysis using phospho-specific antibodies

Chemotaxis and cell migration assays:
Similar to studies on L. pneumophila effects on D. discoideum motility , researchers can:

  • Use under-agarose or Boyden chamber migration assays

  • Compare wild-type cells with fslP knockouts or overexpression strains

  • Track single cell movement to assess directionality and velocity

Development and differentiation assays:

  • Plate D. discoideum cells on non-nutrient agar

  • Monitor and quantify developmental stages

  • Compare timing and morphology between wild-type and fslP-modified strains

These functional assays would provide comprehensive insights into fslP's role in D. discoideum signaling, development, and cellular behavior.

How should researchers analyze microscopy data from fslP localization studies?

Microscopy data from fluorescently tagged fslP studies requires rigorous analysis methods to derive meaningful insights. Based on established approaches in D. discoideum research, consider the following workflow:

Image acquisition optimization:

  • Use appropriate exposure times to avoid photobleaching

  • Acquire Z-stacks for 3D reconstruction

  • Include proper controls (untransfected cells, free fluorescent protein)

Quantitative colocalization analysis:

  • Use dual-labeled cells (fslP-GFP with organelle markers)

  • Calculate Pearson's correlation coefficient and Manders' overlap coefficient

  • Perform statistical analysis across multiple cells and experiments

Similar approaches have been used successfully in D. discoideum for proteins like calnexin-GFP, an ER-specific transmembrane protein used as an LCV marker .

Dynamic localization using live-cell imaging:

  • Image cells at defined intervals (e.g., every 30 seconds for 30 minutes)

  • Track protein movement using specialized software

  • Generate velocity and directionality metrics

This approach has been employed for assessing LCV and microtubule dynamics in infected D. discoideum producing fluorescently tagged proteins .

High-throughput analysis using imaging flow cytometry:
For larger datasets, imaging flow cytometry (IFC) can be used, similar to studies that employed IFC to quantify the recruitment of calnexin-GFP or GFP-Sey1 to PI(4)P-positive structures in D. discoideum . This approach allows:

  • Analysis of thousands of cells per sample

  • Automated quantification of protein localization

  • Statistical robustness through large sample sizes

What statistical approaches are most appropriate for analyzing fslP mutant phenotypes?

Experimental design considerations:

  • Use multiple independent clones for each genetic modification

  • Include appropriate controls (parental strain, random integrants)

  • Perform biological replicates (minimum n=3)

  • Consider power analysis to determine sample size

Statistical methods for different data types:

Data TypeRecommended TestsVisualization
Growth ratesTwo-way ANOVA with Tukey's post-hocGrowth curves with error bars
Protein expressiont-test or Mann-Whitney UBox plots or bar graphs
Localization quantificationChi-square testStacked bar charts
Development timingKaplan-Meier analysisSurvival curves
Cell migrationMixed-effects modelsTrack plots and rose diagrams

Addressing variability in D. discoideum:
D. discoideum can show significant clone-to-clone variability. To address this:

  • Use multiple independent transformants

  • Consider nested statistical designs to account for clone effects

  • Report both within-clone and between-clone variability

These approaches build upon statistical methods used in published D. discoideum studies, such as those analyzing cell motility where single cell tracking indicated directionality and velocity of D. discoideum under different conditions .

How can researchers integrate multi-omics data to understand fslP function?

Understanding fslP function comprehensively requires integration of multiple types of omics data. Based on approaches used in D. discoideum research, consider this integrative strategy:

Types of omics data to collect:

  • Transcriptomics: RNA-Seq to identify genes co-regulated with fslP

  • Proteomics: Mass spectrometry to identify interaction partners

  • Phosphoproteomics: Analysis of signaling changes in fslP mutants

  • Metabolomics: Metabolite profiling to identify downstream effects

Integration approaches:

  • Pathway enrichment analysis:

    • Map differentially expressed genes/proteins to known pathways

    • Identify pathway nodes where multiple data types converge

  • Network analysis:

    • Construct protein-protein interaction networks centered on fslP

    • Overlay expression changes to identify active network modules

  • Temporal integration:

    • Collect data at multiple time points during development

    • Create temporal maps of changes across different omics layers

This integrated approach is similar to studies that have analyzed transcriptional changes in D. discoideum under different conditions, revealing complex regulatory interactions . For fslP, such integration would provide a systems-level understanding of its function within cellular signaling networks.

What are the most promising future directions for fslP research in D. discoideum?

Based on current knowledge and methodologies in D. discoideum research, several promising directions emerge for advancing our understanding of fslP:

Structural biology approaches:

  • Cryo-EM studies of purified fslP to determine 3D structure

  • Structure-guided mutagenesis to identify critical functional domains

  • Computational modeling of ligand binding and protein dynamics

Development of fslP-specific tools:

  • Generation of conformation-specific antibodies

  • Development of small molecule modulators (activators/inhibitors)

  • Creation of optogenetic variants for temporal control of activity

Systems biology integration:

  • Multi-omics profiling of fslP mutants across developmental stages

  • Identification of fslP-dependent signaling networks

  • Computational modeling of pathway dynamics

Comparative studies across species:

  • Functional comparison with mammalian Frizzled/Smoothened homologs

  • Evolutionary analysis of conserved functional domains

  • Heterologous expression studies in mammalian systems

These future directions build upon the established strengths of D. discoideum as a model system, including its genetic tractability, availability of molecular tools, and relevance to understanding fundamental cellular processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.