Recombinant Dictyostelium discoideum Frizzled and smoothened-like protein Q (fslQ)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

fslQ is heterologously expressed in E. coli systems for biochemical studies. Key production details include:

ParameterDescription
Expression HostEscherichia coli
TagN-terminal His tag for affinity purification
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C
ReconstitutionDissolved in sterile water or glycerol-containing buffers to prevent aggregation

Research Applications

fslQ serves as a tool for investigating:

  • Evolution of GPCR signaling: Comparative studies with mammalian frizzled receptors .

  • Calcium-dependent processes: Interactions with cytoskeletal proteins (e.g., actin-bundling proteins) .

  • Drug discovery: Dictyostelium proteins are emerging sources of bioactive polyketides and differentiation factors .

Challenges and Future Directions

  • Functional validation: Mechanistic studies are needed to define fslQ’s role in calcium signaling or development.

  • Structural resolution: Cryo-EM or X-ray crystallography could elucidate its calcium-binding conformational changes .

  • Therapeutic potential: Exploration of fslQ-derived peptides for targeting GPCR-related diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Shipping defaults to blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
fslQ; DDB_G0286609; Frizzled and smoothened-like protein Q
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-578
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fslQ
Target Protein Sequence
QDLKLGGSCELIDSNSPCFSKLNYTNFYLQPGDSITQLNKNVSDIIRMLEFTTPECKPNA INIMCLKSYPKCETYNETLSNNTNIIFNLPSLPCNSICLKAETPCKIFIDNFIKDLSCNS NFSNGAPMFPINSTDYEFKESGNFNFNVECNDNIIYDNSSSVINCPAPLLNSKDHVIPGK TTYYYITDSCILDCPFEIYPGKTKILDRTNYTLTSISFITCIFMILTFGVLPNKITHRME SILSFACGGCITALSLFIQSRQDNFNCSSDPGRFKSQSDYLCLLTGLIFQFGAITSIFWS PMIAYDFYITSTLGKIRKFGLYRIVLWSFIFVLTALPAFGGKYSATVATNCWINSDDGSA WQYVSFYIPSWCAMGLICLFSILSVINVSKMYIQTPNNRILFFNIKILITLLLFLFVLTF ASSLKFYMEERMDTYFDAIAVWVECIGKGDPSQCELHAPGYDLKALNIVVIGILGFTVFI GYGLDPIVIHIWMESKKFQWVLKKCRLDKIIKLNNSINNSNNNNNETASTSSGNERKQTT VKMSNLKSTEINQQP
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Frizzled and Smoothened-like protein Q (fslQ) in Dictyostelium discoideum?

Frizzled and Smoothened-like protein Q (fslQ) belongs to a family of G protein-coupled receptors in Dictyostelium discoideum. Similar to other members of this family like fslA, fslB, and fslK, fslQ likely plays a role in cell signaling pathways that regulate development, proliferation, and cell-cell communication in Dictyostelium discoideum. Based on studies of related proteins, fslQ may function in pathways comparable to the Wnt signaling pathway in higher eukaryotes, which involves Frizzled receptors .

How does fslQ compare structurally with other Frizzled family proteins in Dictyostelium?

When examining the structural characteristics of fslQ, researchers should note its relationship to other characterized members of the Frizzled and Smoothened-like protein family in Dictyostelium, such as fslA, fslB, and fslK. These proteins typically contain transmembrane domains characteristic of G protein-coupled receptors. Comparative analysis with fslB and fslK is particularly relevant as these proteins have been shown to influence maximum cell density in Dictyostelium cultures, reaching approximately 13.6 × 10^6 and 13.7 × 10^6 cells/ml respectively, compared to the wild-type maximum of 21.9 × 10^6 cells/ml .

What are the primary cellular functions associated with fslQ?

Based on research with related proteins, fslQ may be involved in regulating cell proliferation, colony formation, and potentially cell-cell signaling in Dictyostelium discoideum. Experimental data from other fsl-family proteins indicates roles in controlling maximum cell density and doubling times during growth phases. For example, fslB and fslK knockout mutants show significantly reduced maximum cell densities compared to wild-type cells while maintaining similar or slightly increased doubling times .

What are the recommended techniques for generating recombinant fslQ?

For generating recombinant fslQ, researchers should consider established methods that have been successful for other Dictyostelium proteins. A combination of hybridoma sequencing and phage display techniques has been effectively used to generate recombinant proteins in Dictyostelium . The process typically involves:

  • Cloning the fslQ gene into an appropriate expression vector

  • Expression in a suitable host system (bacterial, insect, or mammalian cells)

  • Purification using affinity tags such as FLAG or HA epitopes

  • Validation of protein folding and activity through functional assays

These approaches have been successfully used for generating recombinant antibodies against various Dictyostelium antigens, providing reliable reagents for labeling and characterization of proteins .

How can CRISPR/Cas9 technology be employed to study fslQ function?

CRISPR/Cas9 technology can be effectively implemented to study fslQ function through targeted genome editing. The recommended methodology involves:

  • Design of specific sgRNAs targeting the fslQ locus

  • Use of an all-in-one vector for transient expression of both sgRNA and Cas9

  • Transfection into Dictyostelium cells using established protocols

  • Screening and isolation of edited clones

  • Validation of mutations using sequencing

This approach has been successfully applied to edit other genes in Dictyostelium discoideum, such as the frataxin gene, and allows for rapid generation of knockout or knock-in mutants . When designing sgRNAs, targeting highly conserved functional residues can maximize the likelihood of generating functionally relevant mutations.

What are the best methods for detecting and quantifying fslQ expression levels?

For detecting and quantifying fslQ expression levels, researchers should employ a multi-faceted approach:

  • Quantitative PCR for mRNA expression analysis

  • Western blotting using epitope tags or specific antibodies

  • Immunofluorescence microscopy for localization studies

  • Mass spectrometry for protein identification and quantification

When analyzing extracellular levels of recombinant proteins in Dictyostelium, conditioned media assays have proven effective for related proteins. This approach involves collecting media from cell cultures at specific time points and analyzing protein content through immunoblotting or ELISA techniques .

How does fslQ potentially interact with cell proliferation regulation pathways?

Based on studies of related proteins in Dictyostelium, fslQ may participate in autocrine proliferation regulation pathways. Other members of the fsl family (fslB and fslK) have been implicated in controlling cell proliferation and maximum cell density. When investigating fslQ's role, researchers should consider:

  • Generating fslQ knockout strains to assess effects on doubling time and maximum cell density

  • Measuring proliferation rates under various nutrient conditions

  • Comparing colony morphology on bacterial lawns with wild-type cells

  • Analyzing potential interactions with known proliferation regulators like AprA and CfaD

Studies with fslB and fslK mutants have shown they reach significantly lower maximum cell densities (13.6 × 10^6 and 13.7 × 10^6 cells/ml respectively) compared to wild-type cells (21.9 × 10^6 cells/ml) . Similar quantitative analyses should be performed for fslQ mutants.

What is the relationship between fslQ and ubiquitylation/deubiquitylation processes?

As a potential membrane receptor related to Frizzled proteins, fslQ may undergo regulatory ubiquitylation and deubiquitylation processes. In other systems, Frizzled proteins undergo ubiquitylation-dependent trafficking to lysosomes, and deubiquitylation by enzymes like UBPY facilitates recycling to the plasma membrane . When investigating this aspect of fslQ:

  • Examine fslQ for potential ubiquitylation sites

  • Assess whether fslQ undergoes ubiquitylation upon activation

  • Investigate whether ubiquitylation affects fslQ trafficking and degradation

  • Study potential interactions with deubiquitylating enzymes

Research on Frizzled-4 in mammalian cells has shown ubiquitylation appears as high-molecular-weight band shifts in immunoblotting, providing a methodological approach for detecting similar modifications of fslQ .

How can fslQ be utilized as a model for studying G protein-coupled receptor dynamics?

fslQ can serve as a valuable model for studying G protein-coupled receptor dynamics in a simpler eukaryotic system. Advanced research applications include:

  • Investigating receptor trafficking using fluorescently tagged fslQ constructs

  • Analyzing the kinetics of receptor internalization and recycling

  • Identifying interaction partners through co-immunoprecipitation and mass spectrometry

  • Studying the impact of post-translational modifications on receptor function

Similar approaches with other G protein-coupled receptors in Dictyostelium have revealed mechanisms for sensing cell density and mediating cell-cell communication . When designing these experiments, researchers should consider the colony morphology phenotypes observed with other fsl-family proteins to assess receptor functionality.

What are the analytical challenges in resolving contradictory data regarding fslQ function?

When facing contradictory data regarding fslQ function, researchers should implement a systematic analytical approach:

  • Compare experimental conditions across studies (media composition, cell density, growth phase)

  • Validate knockout strains to ensure complete loss of function

  • Use complementation studies to confirm phenotypes are specifically due to fslQ loss

  • Employ multiple methodologies to measure the same parameter

  • Consider redundancy among fsl-family proteins that may mask phenotypes

The cellular context is particularly important for G protein-coupled receptor studies, as their function often depends on the presence of specific ligands or interaction partners. Therefore, experimental conditions should be carefully controlled and reported when studying fslQ function.

How can computational modeling enhance our understanding of fslQ signaling networks?

Computational modeling can significantly enhance understanding of fslQ signaling networks through:

  • Prediction of protein-protein interaction networks based on structural homology

  • Simulation of receptor trafficking dynamics

  • Systems biology approaches to integrate fslQ into known signaling networks

  • Evolutionary analyses to identify conserved functional domains

When developing computational models, researchers should incorporate quantitative data on cell proliferation rates and maximum cell densities from experimental studies. For example, the modeling could account for the significant differences observed in maximum cell densities between wild-type (21.9 × 10^6 cells/ml) and other fsl-family mutants (ranging from 13.6-13.7 × 10^6 cells/ml) .

What are the optimal culture conditions for studying fslQ expression and function?

Optimal culture conditions for studying fslQ expression and function should be carefully controlled:

  • Use axenic medium with defined composition to eliminate variables from bacterial food sources

  • Monitor and maintain cell density below 5 × 10^6 cells/ml during growth phase experiments

  • Control temperature at 22°C for consistency with published Dictyostelium studies

  • Consider the impact of culture format (shaking culture vs. submerged culture) on experimental outcomes

When analyzing colony formation, researchers should compare both bacterial lawn assays and submerged liquid culture methods, as different fsl-family proteins show distinct phenotypes in these conditions. For example, fslK mutants form colonies with well-defined edges and few dispersed cells in submerged culture .

How should researchers approach troubleshooting inconsistent results in fslQ studies?

When troubleshooting inconsistent results in fslQ studies, researchers should consider:

  • Variability in protein expression levels across different preparations

  • Potential degradation of recombinant protein during purification

  • Interference from endogenous proteins in functional assays

  • Differences in cell density or growth phase during experiments

A systematic approach to troubleshooting should include:

  • Detailed documentation of experimental conditions

  • Use of multiple biological and technical replicates

  • Implementation of appropriate controls (positive, negative, and isotype)

  • Validation using complementary methodologies

What are the ethical considerations and 3Rs implementation in fslQ research using Dictyostelium as a model organism?

When designing research studies with fslQ in Dictyostelium, researchers should consider how this model organism contributes to the 3Rs principle (Replacement, Reduction, and Refinement) in research:

  • Dictyostelium provides an ethical alternative to higher organisms for preliminary studies

  • Results from Dictyostelium can inform and potentially reduce subsequent studies in more complex models

  • The simplicity of Dictyostelium allows for efficient optimization of experimental parameters

Dictyostelium discoideum helps implement the 3Rs principle in research and development of disease models based on this organism can be highly beneficial for preliminary drug screening .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.