Recombinant Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein G (fscG)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant fscG is produced in E. coli using plasmid-based expression systems. Key production metrics:

ParameterSpecification
Expression SystemE. coli
Yield>90% purity (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability

The protein retains stability for over 100 generations in culture without selection pressure, a trait critical for large-scale applications .

Research Applications

Recombinant fscG is primarily used in:

  • GPCR Interaction Studies: As a CRD-lacking homolog, it serves as a control to dissect CRD-dependent vs. CRD-independent signaling .

  • Phagosomal Proteomics: Incorporated into lysosomal fractionation studies to identify bacteriolytic machinery .

  • Structural Biology: Its simplified topology (vs. human Frizzled/Smoothened) aids in transmembrane protein crystallization trials .

Key Challenges and Future Directions

  • Functional Characterization: No direct evidence links fscG to specific pathways. Knockout studies in D. discoideum are needed .

  • Therapeutic Potential: Frizzled/Smoothened proteins are oncology targets; fscG’s CRD absence may inspire engineered inhibitors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
fscG; DDB_G0292156; Frizzled/smoothened-like sans CRD protein G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-453
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fscG
Target Protein Sequence
QSLPSLPSPTIYKSSQCRGDLVYRNVSNRMEDEKIGFTFVQYNGTYQSCVIPCPSPFFTL DEWNKFLYMSLVMGTISFLCGLFLLITYSPIVNKTHNRHTIGVMCMSFGVCLAMCSDMWN FGSNFTDQKSICPSPGQYLTTSNSRCLGSGIVLQFGGVFGFLNWTLLSFDLFMNIKGIIT KNYDKYYFVATFIIAIIFTFVPIVNDQYSMSYIGLGCWLGSAVYQLIFFWILLSICLIVS SVFIILILKEIYIIIKQSKQKTSLKGNIRPLLCITVTSFAFFYMFFYYISIVIEGDYYER ILNEYTDCLMDPTKDVSECKFPRMSVANEFVFLLCLRLLGIGAFIFYGINKEVKKIWLNS FWFNNSFVGKYIGSKRSMGNDITNSYASKAYSKNYNNNNSINSYNSGLELSIIDMSCNKD DNFKPIIIK
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a recombinant protein expression system?

Dictyostelium discoideum is a cellular slime mold that exists in both unicellular and multicellular forms, making it an exceptional model for studying the genetic and cellular mechanisms at the crossroads between uni- and multicellular life . As a recombinant protein expression system, D. discoideum offers several advantages:

  • It is a eukaryotic host capable of efficiently secreting recombinant proteins with correct post-translational modifications

  • It can produce significant yields of recombinant proteins (up to 20mg/l for some proteins) in standard peptone-based growth media

  • The expression of recombinant proteins can remain stable for at least one hundred generations without selection pressure

  • Signal peptides are correctly cleaved from secreted recombinant products

  • It contains numerous orthologs of genes associated with human diseases, making it valuable for functional studies

This unique combination of characteristics makes D. discoideum particularly suited for expressing proteins where eukaryotic processing is important but mammalian cell culture limitations are prohibitive.

How does the Frizzled/smoothened-like sans CRD protein family function in Dictyostelium discoideum?

The Frizzled/smoothened-like sans CRD protein family in D. discoideum, which includes fscG and related proteins like fscH, functions primarily in developmental signaling pathways. While specific details for fscG are being elucidated, insights from the related fscH protein demonstrate:

  • These proteins are involved in interpreting extracellular signals, particularly cAMP-mediated communication

  • They participate in regulating the actin cytoskeleton during development

  • Their proper expression levels are critical for developmental progression; overexpression can arrest development at specific stages (e.g., the mound stage)

  • They influence cell polarity, motility, and the organization of F-actin during development

  • They play specific roles in chemotaxis toward certain signals (like cAMP) without affecting general motility or response to other chemoattractants (like folate)

Understanding these functional aspects is essential for researchers designing experiments to investigate the specific roles of fscG in developmental and cellular processes.

What are the structural characteristics of Recombinant Dictyostelium discoideum Frizzled/smoothened-like sans CRD proteins?

The Frizzled/smoothened-like sans CRD proteins in D. discoideum have distinct structural features that differentiate them from canonical Frizzled receptors in other organisms. Based on available data for the related fscH protein:

  • They lack the characteristic cysteine-rich domain (CRD) found in typical Frizzled receptors (hence "sans CRD")

  • The full mature protein length typically spans 500+ amino acids (e.g., positions 22-533 for fscH)

  • The protein contains multiple transmembrane domains characteristic of cell surface receptors

  • Recombinant versions often include affinity tags (such as His-tags) for purification purposes

  • The amino acid sequence shows regions of hydrophobicity consistent with membrane-spanning segments

When expressed recombinantly, these proteins can be engineered with various tags and in different expression systems (e.g., E. coli) to facilitate purification and functional studies.

What are the optimal experimental conditions for expressing and purifying recombinant fscG/fscH proteins?

Successful expression and purification of recombinant Frizzled/smoothened-like sans CRD proteins require careful optimization of expression systems and purification protocols:

Expression Systems and Conditions:

ParameterD. discoideum ExpressionE. coli Expression
VectorpDEX-based vectorspET series or similar
Selection markerG418 resistanceAmpicillin/kanamycin
Culture mediumHL5 medium with peptoneLB or TB medium
InductionConstitutive or inducibleIPTG induction (0.1-1.0 mM)
Growth temperature22°C16-30°C (lower for membrane proteins)
Expression yieldUp to 20mg/l (protein-dependent)Variable (1-10 mg/l typical)
Expression time2-4 days4-16 hours post-induction

Purification Protocol for His-tagged Proteins:

  • Harvest cells by centrifugation (4000g, 15 min, 4°C)

  • For secreted proteins (D. discoideum): collect supernatant

  • For intracellular expression (E. coli): lyse cells using appropriate buffer with protease inhibitors

  • Clarify lysate by centrifugation (16,000g, 30 min, 4°C)

  • Apply to Ni-NTA column equilibrated with binding buffer

  • Wash with increasing imidazole concentrations (10-40 mM)

  • Elute with high imidazole (250-500 mM)

  • Dialyze against Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • For long-term storage, add glycerol to 50% final concentration and store at -20°C/-80°C

The choice between expression systems depends on research goals: D. discoideum expression provides proteins with native post-translational modifications but lower yields, while E. coli provides higher yields but potentially differences in protein folding and glycosylation.

How can researchers design rigorous experiments to investigate fscG function in actin cytoskeletal regulation?

Investigating the function of fscG in actin cytoskeletal regulation requires careful experimental design to avoid confounding variables and ensure reproducible results:

Experimental Approaches:

  • Gene Expression Manipulation:

    • Generate knockout, knockdown, and overexpression strains using CRISPR-Cas9 or homologous recombination

    • Create rescue constructs with wild-type and mutated versions of fscG

    • Develop inducible expression systems for temporal control

  • Cytoskeletal Analysis Techniques:

    • Fluorescent phalloidin staining for F-actin visualization

    • Live-cell imaging with LifeAct-GFP for dynamic actin monitoring

    • Quantitative analysis of F-actin polymerization using flow cytometry

    • Electron microscopy for detailed cytoskeletal architecture

  • Functional Assays:

    • Chemotaxis assays toward cAMP and folate gradients

    • Cell substrate adhesion measurements

    • Filopodia and pseudopodia formation analysis

    • Development progression monitoring

Avoiding Experimental Confounds:

  • Ensure proper experimental controls to account for vector backbone effects

  • Use multiple clones to rule out insertional mutagenesis effects

  • Implement incomplete factorial designs with appropriate controls

  • Include wild-type rescue experiments to confirm phenotype specificity

  • Monitor expression levels to avoid artifacts from extreme overexpression

For analyzing actin dynamics specifically, researchers should employ temporal analysis of F-actin polymerization following cAMP stimulation, comparing wild-type cells with fscG mutants to identify specific defects in cytoskeletal reorganization.

What analytical approaches should be used to resolve contradictory data about fscG's role in cell signaling?

When faced with contradictory data regarding fscG's role in cell signaling, researchers should implement a multi-faceted analytical strategy:

Data Analysis Framework:

Resolution Strategies for Contradictory Findings:

A comprehensive approach would include systematic variation of experimental conditions to identify contextual factors affecting fscG function, such as developmental stage, nutrient conditions, cell density, and expression levels of interaction partners.

What methods are most effective for characterizing fscG's interactions with cAMP signaling pathways?

Characterizing the interactions between fscG and cAMP signaling pathways requires integrating multiple methodological approaches:

Primary Investigation Methods:

  • Biochemical Interaction Analysis:

    • Co-immunoprecipitation of fscG with cAMP pathway components

    • Proximity labeling (BioID or APEX) to identify interaction partners in living cells

    • Surface plasmon resonance to measure binding kinetics and affinities

  • Functional Response Assays:

    • Real-time cAMP level monitoring using FRET-based sensors

    • PKA activity assays following cAMP stimulation

    • Intracellular calcium measurements in response to cAMP

    • Actin polymerization kinetics after cAMP addition

  • Cell Biological Approaches:

    • Live imaging of cells expressing fluorescently-tagged fscG during cAMP stimulation

    • Quantification of cell polarization and filopodia formation

    • Chemotaxis chamber assays with defined cAMP gradients

    • Analysis of developmental progression in mutants versus wild-type

Based on findings with the related SecG protein, researchers should pay particular attention to developmental timing, as these proteins peak during specific developmental stages like aggregation and mound formation . Additionally, investigating whether fscG influences the expression of cAMP receptors (like carA) would help clarify whether observed phenotypes result from direct signaling effects or from altered receptor expression.

How can evolutionary analysis of fscG contribute to understanding its functional significance?

Evolutionary analysis of fscG can provide crucial insights into its functional conservation and specialization:

Evolutionary Analysis Approaches:

  • Comparative Genomics:

    • Identify orthologs across Dictyostelid species and other amoebozoa

    • Compare gene structure, regulatory elements, and synteny

    • Determine the origin of sans-CRD Frizzled/smoothened-like proteins

  • Sequence-Function Relationship:

    • Identify conserved domains and motifs across species

    • Map functional conservation to sequence conservation

    • Perform domain swapping experiments between orthologs

  • Evolutionary Developmental Analysis:

    • Compare expression patterns across species with different developmental complexities

    • Examine functional complementation across species

    • Reconstruct the evolutionary history of fscG in relation to the emergence of multicellularity

This evolutionary perspective is particularly valuable for Dictyostelium proteins, as they exist at the crossroads between unicellular and multicellular life forms. Understanding how fscG-related proteins evolved alongside the development of multicellularity could reveal fundamental principles about signal transduction in developmental processes.

What are common technical challenges in recombinant fscG expression and how can they be overcome?

Researchers commonly encounter several technical challenges when working with recombinant fscG:

Common Challenges and Solutions:

ChallengePossible CausesRecommended Solutions
Low expression yieldProtein toxicity to hostUse inducible systems, lower growth temperature
Codon usage biasOptimize codons for expression host
Protein instabilityAdd protease inhibitors, express as fusion protein
Protein insolubilityMembrane protein natureOptimize detergent selection and concentration
Incorrect foldingExpress in eukaryotic host (D. discoideum)
AggregationAdd solubility tags, lower expression temperature
Poor purificationInaccessible affinity tagReposition tag or use alternative tag
Nonspecific bindingIncrease salt/detergent in wash buffers
Proteolytic degradationAdd protease inhibitors, purify at 4°C

When expressing membrane proteins like fscG, particular attention should be paid to the purification buffer components. The addition of appropriate detergents (CHAPS, DDM, or Triton X-100) at concentrations above their critical micelle concentration is essential for maintaining protein solubility and native conformation.

How should researchers interpret phenotypic data from fscG mutants in the context of developmental studies?

Interpreting phenotypic data from fscG mutants requires careful consideration of several factors:

  • Developmental Context:

    • The timing of phenotype manifestation relative to fscG expression patterns

    • Comparison with known developmental marker progression

    • Analysis of cell-autonomous versus non-cell-autonomous effects

  • Mechanistic Interpretation:

    • Direct versus indirect effects on developmental processes

    • Primary cytoskeletal defects versus secondary signaling consequences

    • Cell-type specific phenotypes within the multicellular structure

  • Quantitative Assessment:

    • Statistical analysis of developmental timing across multiple independent clones

    • Dose-dependent relationships between expression levels and phenotype severity

    • Penetrance and expressivity of phenotypes across populations

Based on studies of related proteins like SecG, researchers should particularly focus on aggregation, mound formation, chemotaxis behaviors, and F-actin organization when characterizing fscG mutants . The observation that SecG overexpression causes developmental arrest at the mound stage suggests that proper expression levels of these proteins are critical for normal development, highlighting the importance of quantitative expression analysis alongside phenotypic characterization.

What emerging technologies might enhance our understanding of fscG function in Dictyostelium development?

Several cutting-edge technologies hold promise for advancing our understanding of fscG function:

  • Single-Cell Multi-omics:

    • Single-cell RNA-seq to identify cell-type specific effects of fscG mutation

    • Single-cell proteomics to characterize protein-level changes

    • Spatial transcriptomics to map expression patterns within multicellular structures

  • Advanced Imaging Approaches:

    • Super-resolution microscopy to visualize subcellular localization

    • Light-sheet microscopy for whole-organism developmental imaging

    • FRET/FLIM for protein-protein interaction studies in living cells

  • Genome Engineering:

    • CRISPR-Cas9 base editing for precise sequence modifications

    • Optogenetic control of fscG expression or activity

    • Synthetic regulatory circuits to control fscG in specific developmental contexts

  • Systems Biology Integration:

    • Network modeling of fscG interactions within developmental pathways

    • Multi-scale models connecting molecular function to multicellular phenotypes

    • Comparative systems approaches across evolutionary diverse Dictyostelids

These emerging approaches will enable researchers to build more comprehensive models of how fscG contributes to the complex processes of Dictyostelium development and cell signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.