Recombinant Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein J (fscJ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cell Signaling

fscJ belongs to the Frizzled/smoothened-like GPCR family and regulates:

  • Autocrine proliferation repression: Modulates cell density sensing via secreted factors like AprA and CfaD .

  • Chemorepulsion: Mediates dispersal signals to prevent overcrowding .

  • Cell cycle regulation: Knockout mutants (e.g., fscE¯) exhibit altered doubling times and reduced maximal cell densities :

Cell TypeDoubling Time (h)Max Cell Density (10⁶ cells/mL)
Wild-type14.3 ± 0.221.9 ± 1.7
fscE¯15.8 ± 0.5*12.0 ± 0.8**

*P < 0.05; **P < 0.01 vs. wild-type

Research Applications

Recombinant fscJ is utilized in:

  • ELISA assays: Quantifying protein interactions (e.g., ligand binding studies) .

  • Functional studies: Investigating GPCR signaling in Dictyostelium chemotaxis and development .

  • Mutant complementation: Restoring wild-type phenotypes in fscJ¯ strains .

Evolutionary and Genomic Insights

Parallel evolution studies highlight fscJ’s homologs (e.g., grlG) as key regulators of social behavior in Dictyostelium. SNPs in related GPCRs correlate with altered cooperative behaviors under low-relatedness conditions .

Handling and Stability

  • Storage: -20°C/-80°C (avoid repeated freeze-thaw cycles) .

  • Buffer compatibility: Tris/PBS with glycerol for long-term stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
fscJ; DDB_G0292102; Frizzled/smoothened-like sans CRD protein J
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-407
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
fscJ
Target Protein Sequence
QIACPSPFLYRATNDTVGDYDLGYQYINIGKPLPPQLSFLNNCLMPCQSSFFEQDSWNSF NKLVKQMGAVAFTCSAIIMIIYGPLMNRSFFKFDRHTITVFCFALSTFFIGVSDLMFATN DVDMVCPESHRYARQTDKTCATNGVLFQFGWLGSVMWFAFLSIDGFFRASGKKMNKIAFA IVLASIWILNIVLSFAPMGGDQYGAYFVGQVNCWILVKNWQYAFFWAELIVSLAIGFVGI CLTIYSLIRKTSDGNTLKHVTPLILVFLLFCQYLYMIIFYGIINEKKDHYQNILAEQVGC IFNNALAKMKVPGIVYAGECTFNETITFSSQYAFLFFVRLLGIEIFAFYLFSKETLLLIK SSYIATMFGLGDKDAYDVELEETD
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of Frizzled/smoothened-like sans CRD proteins in Dictyostelium discoideum?

Frizzled/smoothened-like sans CRD proteins in Dictyostelium discoideum appear to function as components in signaling pathways that regulate cell proliferation and movement. Based on research with related proteins, these transmembrane proteins likely mediate cellular responses to external signals . For example, fscE has been implicated in proliferation regulation pathways, as fscE-knockout cells show significantly altered doubling times (15.8 ± 0.5 hours compared to wild-type 14.3 ± 0.2 hours) and reduced maximum cell density (12.0 ± 0.8 × 10^6 cells/ml compared to wild-type 21.9 ± 1.7 × 10^6 cells/ml) .

To investigate the function of a specific protein such as fscJ, researchers should:

  • Generate knockout strains using targeted gene disruption

  • Measure proliferation rates and maximum cell densities

  • Assess colony morphology on bacterial lawns and in submerged culture

  • Test responses to known signaling molecules like AprA and CfaD

  • Compare phenotypic characteristics with wild-type cells and other related protein mutants

What structural characteristics define the Frizzled/smoothened-like sans CRD protein family?

Frizzled/smoothened-like sans CRD proteins are characterized by their membrane-spanning regions but lack the cysteine-rich domain (CRD) typically found in classical Frizzled receptors. As observed with fscF, these proteins contain multiple transmembrane domains with intracellular and extracellular regions that facilitate signal transduction . The amino acid sequence of fscF (which serves as a model for understanding related proteins like fscJ) includes multiple hydrophobic regions consistent with transmembrane segments, as well as regions associated with signal transduction .

For studying the structure of these proteins:

  • Perform sequence analysis and hydropathy plots to identify transmembrane regions

  • Use protein prediction tools to identify functional domains

  • Compare with established structural models of related proteins

  • Consider expressing truncated versions to determine functional domains

  • Utilize tagging strategies that minimize interference with protein function

How do you generate and validate a knockout strain for studying Frizzled/smoothened-like sans CRD proteins?

To generate a knockout strain for studying proteins like fscJ:

  • Design targeting constructs with homology arms flanking the target gene

  • Transform Dictyostelium cells with the knockout construct

  • Select transformants using appropriate antibiotics

  • Verify gene disruption through PCR, Southern blotting, and RT-PCR

  • Confirm protein absence using Western blotting (if antibodies are available)

Validation should include functional analysis similar to what was performed for other fsc family members, such as measuring growth curves, calculating doubling times, and determining maximum cell densities . For example, with fscE knockout strains, researchers documented a statistically significant increase in doubling time (15.8 ± 0.5 hours, p < 0.05) compared to wild-type cells . You should also examine colony morphology both on bacterial lawns and in submerged culture, as these characteristics often reflect changes in cell-cell signaling.

How do Frizzled/smoothened-like sans CRD proteins interact with the AprA/CfaD chalone system in Dictyostelium?

The interaction between Frizzled/smoothened-like sans CRD proteins and the AprA/CfaD chalone system appears complex and potentially involves multiple receptors. Research with fscE knockouts showed these cells were insensitive to CfaD-induced proliferation inhibition while maintaining sensitivity to AprA . This suggests:

  • Different Frizzled/smoothened-like sans CRD proteins may mediate responses to different chalones

  • There may be functional redundancy in these signaling pathways

  • The receptors might function as part of larger protein complexes

To investigate these interactions with fscJ or similar proteins:

  • Perform sensitivity assays with recombinant AprA and CfaD on knockout strains

  • Measure proliferation rates in the presence of varying concentrations of these chalones

  • Use co-immunoprecipitation studies to identify physical interactions

  • Create double knockouts with other signaling components

  • Perform cell surface binding studies with labeled ligands

The table below summarizes how different receptor knockouts respond to AprA and CfaD based on available research:

Receptor KnockoutSensitivity to rAprASensitivity to rCfaDDoubling Time (h)Max Cell Density (10^6 cells/ml)
Wild-typeSensitiveSensitive14.3 ± 0.221.9 ± 1.7
fscE^-SensitiveInsensitive15.8 ± 0.5*12.0 ± 0.8**
grlH^-InsensitiveSensitive13.0 ± 0.1**20.8 ± 1.3
grlB^-InsensitiveInsensitive14.0 ± 0.423.4 ± 1.5

*p < 0.05, **p < 0.01 compared to wild-type

What methodologies are most effective for studying the localization and trafficking of fscJ protein in Dictyostelium cells?

For studying localization and trafficking of Frizzled/smoothened-like sans CRD proteins:

  • Generate GFP or other fluorescent protein fusions, preferably with the tag positioned to minimize functional disruption

  • Use confocal microscopy for live cell imaging to track protein movement

  • Perform immunofluorescence studies if specific antibodies are available

  • Conduct subcellular fractionation followed by Western blotting

  • Use photoactivatable or photoconvertible fluorescent proteins to track specific protein populations over time

When designing these experiments, consider that transmembrane proteins like fscF contain multiple hydrophobic domains and specific structural elements that might be disrupted by tags . Based on the amino acid sequence information from related proteins like fscF, choose tag insertion sites that minimize disruption of transmembrane domains or functional motifs.

For validation, complement these approaches with functional assays to ensure that tagged proteins retain normal activity:

  • Growth rate analysis

  • Cell density measurements

  • Response to known ligands

  • Rescue of knockout phenotypes with the tagged construct

How do you design appropriate controls for proliferation inhibition assays with recombinant proteins in Dictyostelium research?

Designing robust controls for proliferation inhibition assays requires careful consideration:

  • Vehicle controls: Include buffer-only treatments matching the recombinant protein preparation

  • Dose-response curves: Test multiple concentrations of recombinant proteins

  • Heat-inactivated controls: Use denatured recombinant proteins to control for non-specific effects

  • Genetic controls: Include strains with known response profiles (e.g., wild-type positive control and known non-responder negative control)

  • Temporal controls: Monitor proliferation at multiple time points

In studies with recombinant AprA and CfaD, researchers tracked proliferation by counting cells at 12-hour intervals over 48-72 hours . Wild-type cells showed approximately 20% inhibition of proliferation when treated with these recombinant proteins, while receptor knockouts showed differential responses . Analysis should include statistical comparisons between treatment and control conditions, with significance typically assessed at p < 0.05.

What approaches can resolve contradictory data between chemorepulsion and proliferation inhibition pathways mediated by Frizzled/smoothened-like receptors?

Research has revealed complex and sometimes contradictory relationships between chemorepulsion and proliferation inhibition pathways in Dictyostelium. For example, some receptor knockouts (like grlH^-) showed insensitivity to AprA-induced proliferation inhibition but unexpected attraction rather than mere insensitivity to AprA in chemorepulsion assays .

To resolve such contradictions:

  • Perform detailed time-course experiments to identify potential temporal differences in signaling

  • Create double or triple knockout strains to identify redundant or compensatory pathways

  • Use phosphoproteomic approaches to map signaling cascades activated by different stimuli

  • Employ pharmacological inhibitors to target specific downstream effectors

  • Develop computational models integrating multiple signaling inputs

The Insall chamber assay has been effective for quantifying chemorepulsion responses . This approach allows precise measurement of directional cell movement in response to protein gradients. When analyzing results, it's important to distinguish between three possible outcomes: movement away from the source (repulsion), movement toward the source (attraction), or random movement (insensitivity).

How can SMART experimental designs enhance research on Frizzled/smoothened-like sans CRD protein function?

Sequential Multiple Assignment Randomized Trial (SMART) designs could significantly advance understanding of complex signaling systems involving proteins like fscJ:

  • SMART designs allow for the systematic investigation of adaptive intervention strategies

  • They enable the assessment of sequential treatments or conditions, particularly useful for studying dynamic cellular responses

  • These designs can reveal optimal sequences of interventions or treatments

For studying fscJ function, a SMART design might involve:

  • Initial randomization of cells to different stimulation conditions

  • Secondary randomization based on initial response patterns

  • Analysis of which sequence of treatments produces optimal cellular responses

For example, cells could be initially treated with or without a potential ligand, then subsequently challenged with proliferation-promoting or inhibiting factors, with sequential measurements of response variables. This approach is particularly valuable when the response to one treatment may influence the effect of subsequent treatments, as is common in complex signaling networks .

What are the optimal expression and purification methods for generating functional recombinant Frizzled/smoothened-like sans CRD proteins?

Based on available information about related proteins, effective expression and purification of Frizzled/smoothened-like sans CRD proteins requires:

  • Selection of an appropriate expression system (bacterial systems may be challenging for transmembrane proteins; consider eukaryotic systems)

  • Optimization of codon usage for the expression host

  • Addition of purification tags that minimize functional disruption

  • Establishment of proper detergent conditions for membrane protein solubilization

  • Implementation of quality control steps to ensure proper folding

For storage and handling:

  • Store in Tris-based buffer with 50% glycerol as used for similar proteins

  • Maintain at -20°C for short-term storage or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Prepare working aliquots stored at 4°C for up to one week

Verification of protein quality should include SDS-PAGE, Western blotting, and functional assays to confirm that the recombinant protein behaves similarly to the native protein.

How can contradictory phenotypes in different Frizzled/smoothened-like sans CRD protein knockout strains be reconciled?

Research with different receptor knockouts has revealed apparently contradictory phenotypes. For example, some knockouts (like fscE^-) show both increased doubling time and decreased maximum cell density, while others show only one of these phenotypes .

To reconcile these contradictions:

  • Consider that different receptors may regulate distinct aspects of cell proliferation and density sensing

  • Investigate whether receptors function in parallel or sequential pathways

  • Examine the accumulation of extracellular factors like AprA and CfaD in different knockout strains

  • Create and analyze double knockout strains to identify genetic interactions

  • Employ quantitative modeling to integrate multiple regulatory inputs

The systematic approach used in the study of various receptor knockouts provides a model for resolving such contradictions . This includes comprehensive phenotypic characterization (doubling time, maximum cell density, colony morphology) and functional testing (response to recombinant proteins, chemorepulsion assays).

What data analysis methods are most appropriate for quantifying subtle phenotypes in Frizzled/smoothened-like sans CRD protein research?

For quantifying subtle phenotypes:

  • Use statistical approaches that account for biological variability:

    • Report means with standard errors from multiple independent experiments

    • Apply appropriate statistical tests (t-tests for pairwise comparisons, ANOVA for multiple comparisons)

    • Consider non-parametric tests if data do not meet normality assumptions

  • Implement rigorous data collection protocols:

    • Standardize experimental conditions

    • Perform experiments in multiple independent replicates (n ≥ 3)

    • Include appropriate controls in each experiment

  • Consider advanced analytical approaches:

    • Time-series analysis for growth curves and dynamic responses

    • Image analysis algorithms for quantifying colony morphology

    • Machine learning approaches for identifying complex phenotypic patterns

In published research on related proteins, statistical significance was typically assessed at p < 0.05 or p < 0.01 levels using t-tests compared to wild-type . Doubling times were calculated from growth curves, and chemorepulsion was quantified using directional analysis of cell movement in gradient chambers.

What are the most promising research directions for understanding the complete signaling network involving Frizzled/smoothened-like sans CRD proteins in Dictyostelium?

Future research should focus on:

  • Comprehensive characterization of the entire family of Frizzled/smoothened-like sans CRD proteins, including fscJ

  • Identification of specific ligands for each receptor

  • Mapping of downstream signaling pathways using phosphoproteomics and transcriptomics

  • Investigation of potential receptor heterodimerization or complex formation

  • Development of computational models integrating multiple signaling inputs and outputs

The discovery that multiple receptors (GrlB, GrlD, GrlE, GrlH, FslB, FscE) are required for responses to AprA and CfaD suggests complex signaling networks with potential redundancy and cross-regulation . Future studies should aim to create a comprehensive map of these interactions to understand how they collectively regulate cell proliferation, density sensing, and movement.

How can emerging technologies advance our understanding of Frizzled/smoothened-like sans CRD protein function?

Emerging technologies that could advance this research include:

  • CRISPR-Cas9 genome editing for more precise genetic manipulations

  • Single-cell analysis techniques to capture heterogeneity in cellular responses

  • Advanced microscopy methods such as super-resolution imaging for detailed localization studies

  • Cryo-EM for structural determination of membrane protein complexes

  • Optogenetic approaches to precisely control receptor activation in time and space

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.