Recombinant Dictyostelium discoideum Latrophilin receptor-like protein A (lrlA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lrlA; DDB_G0286037; Latrophilin receptor-like protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
lrlA
Target Protein Sequence
MPSQLLNTVLSYLTDILLSLSIVGSFLTIFTFMLYPKLRSYPIKLIIYLCMSIVFSLFFF EISFRSSNSLFCIPAAILVHYFFLANFFWTFSVSFNFFQMIVKRNRDSEFYERYYHLISW GIPFIIIIFCAAFKKYVDRGGFCYLEDQYSVYFGFFMPGVIIVCSNICIYVFVAKEIYKT LRHTPTQKRQTVKEFRVYFSIFVSIGSSWIFGFIYMFSDSNSIIGYIFLILFSISTSLQG FFIFISYCLNYKVFAHYSRSFTQYGVSFFKRWENLDGETTQSGPTGTTDSSSTMTSTTTT TNVYSA
Uniprot No.

Target Background

Database Links
Protein Families
G-protein coupled receptor 2 family, LN-TM7 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Latrophilin receptor-like protein A (lrlA) in Dictyostelium discoideum?

Latrophilin receptor-like protein A (lrlA) in Dictyostelium discoideum is a G-protein-coupled receptor (GPCR) that shares structural similarities with mammalian latrophilins. In Dictyostelium, GPCRs play crucial roles in detecting extracellular signals and mediating cellular responses during development and chemotaxis. The cAMP receptor cAR1 is a well-characterized GPCR in Dictyostelium that couples to the Gα2 subunit-containing heterotrimer to initiate downstream signaling cascades . Like other GPCRs, lrlA likely cycles between the cytosol and plasma membrane, with its localization influenced by ligand binding and activation status . It likely participates in cell-cell communication or environmental sensing pathways similar to other GPCRs in this organism.

What expression systems are most suitable for recombinant lrlA production?

For recombinant lrlA production, several expression systems can be employed depending on research needs:

  • Homologous expression in Dictyostelium: This approach maintains native post-translational modifications and folding. Dictyostelium cells can be transformed by electroporation and selected with antibiotics such as blasticidin (10 μg/ml) or G418 (20-40 μg/ml) . This system is particularly valuable when studying protein function in its native cellular context.

  • E. coli-based expression: For structural studies requiring larger protein quantities, bacterial expression systems can be used, though these may require optimization for membrane protein expression.

  • Mammalian cell expression: For studies comparing function with mammalian latrophilins, HEK293 or CHO cells may provide appropriate glycosylation and folding machinery.

The choice depends on experimental goals: functional studies benefit from Dictyostelium expression, while structural or biochemical analyses might require heterologous systems with higher yields.

How do I verify successful expression of recombinant lrlA?

Verification of recombinant lrlA expression requires multiple complementary approaches:

Western blotting: Using antibodies against an epitope tag (His, FLAG, etc.) or against lrlA itself. For membrane proteins like lrlA, sample preparation requires careful consideration:

  • Use appropriate detergents for membrane protein solubilization

  • Include protease inhibitors during extraction

  • Consider using mild lysis conditions to preserve protein structure

Fluorescence microscopy: For GFP-tagged constructs, verify correct membrane localization and distribution patterns. Total internal reflection fluorescence microscopy (TIRFM) can be particularly useful for visualizing membrane-associated proteins .

Functional assays: Verify that the recombinant protein exhibits expected activities, such as ligand binding or downstream signaling activation.

What are the optimal conditions for purifying recombinant lrlA while maintaining its native conformation?

Purifying membrane proteins like lrlA while preserving their native conformation requires careful optimization:

  • Detergent selection: Test a panel of detergents including:

    • Mild detergents (DDM, LMNG) for initial solubilization

    • Shorter chain detergents for crystallization attempts

    • Lipid nanodiscs or amphipols for functional studies

  • Buffer optimization:

    • pH range 7.0-7.5 typically preserves GPCR stability

    • Include stabilizing agents (glycerol 10-15%, cholesterol hemisuccinate)

    • Consider adding specific ligands during purification to stabilize active conformations

  • Temperature considerations:

    • Maintain samples at 4°C throughout purification

    • For long-term storage, flash freeze in liquid nitrogen with cryoprotectants

  • Affinity chromatography:

    • Use tandem affinity tags (His+FLAG) for higher purity

    • Employ gentle elution conditions with imidazole gradients rather than step elutions

Developing rigorous quality control checks at each purification step is essential for ensuring that the purified lrlA retains its native structure and functionality.

What techniques are most effective for studying lrlA-binding partners and signaling complexes?

Multiple complementary approaches can be employed to identify and characterize lrlA-binding partners:

  • Co-immunoprecipitation (Co-IP): Using tagged lrlA to pull down interacting partners, followed by mass spectrometry identification. This approach has been successfully used to study G-protein interactions in Dictyostelium .

  • FRET/BRET assays: Fluorescence (or Förster) resonance energy transfer between tagged lrlA and potential binding partners can reveal direct interactions in living cells. This approach has been successfully used to monitor interactions between G-protein subunits in Dictyostelium, showing how receptor activation affects the dynamics of these interactions .

  • Bimolecular Fluorescence Complementation (BiFC): This technique can visualize protein interactions in living cells by reconstituting a fluorescent protein when two fragments are brought together by interacting proteins.

  • Proteomics approach:

ApproachAdvantagesLimitationsApplication to lrlA research
Proximity labeling (BioID/APEX)Identifies transient interactionsPotential false positivesMapping lrlA interactome
Crosslinking mass spectrometryPreserves spatial informationComplex data analysisDetermining interaction interfaces
Stable isotope labeling (SILAC)Quantitative comparisonRequires specialized mediaComparing wild-type vs. mutant interactions
  • Functional assays: Measuring changes in second messengers (cAMP, calcium) or downstream signaling events following lrlA activation can identify components of the signaling pathway.

How can I measure the dynamics of lrlA trafficking between the plasma membrane and cytosol?

To study lrlA trafficking dynamics:

  • Fluorescence recovery after photobleaching (FRAP): This technique can determine the mobility and exchange rates of lrlA at the plasma membrane. Similar experiments with G-proteins in Dictyostelium have revealed that both inactive and active G-proteins cycle between the cytosol and plasma membrane .

  • Total internal reflection fluorescence microscopy (TIRFM): This approach selectively visualizes fluorescent molecules at or near the plasma membrane, allowing real-time monitoring of protein recruitment and dissociation .

  • pH-sensitive GFP variants: Tagging lrlA with pH-sensitive fluorescent proteins allows distinction between surface and internalized pools based on fluorescence intensity changes.

  • Quantitative image analysis: Develop algorithms to measure:

    • Membrane/cytosol fluorescence intensity ratios

    • Residence time at the membrane

    • Response to stimuli (rate of internalization/recruitment)

When designing these experiments, consider that cAR1 activation in Dictyostelium slows the membrane dissociation rate of the Gα2 subunit while promoting βγ-subunit dissociation . Similar dynamics might apply to lrlA and its associated G-proteins.

How does lrlA function within Dictyostelium signaling networks during development and chemotaxis?

Understanding lrlA's role in Dictyostelium signaling requires examining its impact across multiple developmental stages:

  • Vegetative growth phase: Determine if lrlA expression exhibits heterogeneity within the population, similar to patterns observed with RasD expression, which shows variation that influences later cell fate decisions .

  • Aggregation phase: Investigate whether lrlA modulates cAMP signaling during chemotaxis. The cAMP receptor cAR1 is known to couple to G-proteins containing the Gα2 subunit , and lrlA might interact with similar or different G-protein subunits to influence this process.

  • Mound and slug formation: Assess lrlA's potential role in cell sorting and pattern formation. In Dictyostelium, the Ras-GTPase regulator gefE influences prestalk and prespore cell differentiation , and lrlA might similarly bias cell fate decisions.

  • Culmination and fruiting body formation: Evaluate whether lrlA affects the terminal differentiation process or spore formation.

Experimental approaches should include creating lrlA knockout strains and analyzing phenotypes throughout the developmental cycle (Figure 1), similar to studies conducted for other developmental regulators in Dictyostelium .

What methodologies can determine if lrlA functions as a mechanosensor in Dictyostelium?

To investigate lrlA's potential mechanosensory functions:

  • Substrate stiffness assays: Culture Dictyostelium cells on substrates of varying rigidity and measure:

    • Migration speed and persistence

    • Actin cytoskeleton reorganization

    • Focal adhesion dynamics

    • Compare wild-type and lrlA-knockout strains

  • Micropipette aspiration: Apply controlled mechanical forces to the cell membrane and measure:

    • Calcium influx using fluorescent calcium indicators

    • Recruitment of signaling molecules to the stimulation site

    • Cytoskeletal responses

  • Traction force microscopy: Quantify forces exerted by cells on their substrate:

    • Seed cells on elastic substrates embedded with fluorescent beads

    • Calculate displacement fields as measure of cellular forces

    • Compare force generation between wild-type and modified lrlA expression

  • FRET-based tension sensors: Insert tension-sensitive modules into lrlA to directly measure conformational changes under mechanical stress.

How do I design experiments to identify specific ligands for lrlA?

Identifying ligands for orphan receptors like lrlA requires systematic screening approaches:

  • Cell-based screening assays:

    • Generate stable cell lines expressing lrlA fused to a reporter system (calcium sensors, BRET-based sensors)

    • Screen candidate libraries including:

      • Peptides derived from Dictyostelium secretome

      • Bacterial metabolites (as Dictyostelium feeds on bacteria)

      • Known GPCR ligands from related receptors

  • Direct binding assays:

    • Surface plasmon resonance (SPR) with purified lrlA

    • Microscale thermophoresis for detecting subtle binding events

    • Radioligand binding assays if a known ligand can be radiolabeled

  • Computational approaches:

    • Homology modeling based on related receptors with known ligands

    • Molecular docking with virtual compound libraries

    • Sequence analysis to identify conserved binding pockets

  • Activity-based approaches:

    • Fractionation of Dictyostelium conditioned media followed by activity testing

    • Testing extracts from different developmental stages to identify stage-specific ligands

How can CRISPR-Cas9 gene editing be optimized for studying lrlA function in Dictyostelium?

Optimizing CRISPR-Cas9 for Dictyostelium lrlA modification requires:

  • Guide RNA design considerations:

    • Select target sites with minimal off-target effects

    • Consider GC content optimal for Dictyostelium (30-70%)

    • Target conserved functional domains for knockouts

    • For knock-ins, target non-essential regions or termini

  • Delivery methods:

    • Electroporation protocols optimized for Dictyostelium (typical settings: 0.85 kV/cm, 2 pulses, 1 ms)

    • Expression vectors with strong Dictyostelium promoters (actin15, gpd)

    • Ribonucleoprotein (RNP) complex delivery for transient expression

  • Repair template optimization:

    • Homology arms of 500-1000 bp for efficient integration

    • Codon optimization for Dictyostelium (avoid rare codons)

    • Include selection markers flanked by loxP sites for later removal

  • Screening strategies:

    • PCR-based genotyping to verify successful editing

    • Functional assays to confirm phenotypic changes

    • Whole-genome sequencing to check for off-target effects

Since Dictyostelium is haploid during vegetative growth, gene modifications can be more straightforward than in diploid organisms, making it an excellent system for genetic manipulation .

What approaches can resolve contradictory data about lrlA localization and function?

When facing contradictory data regarding lrlA localization or function, implement these systematic approaches:

  • Validation with multiple independent techniques:

    • Compare results from different tagging strategies (N-terminal vs. C-terminal)

    • Use both antibody-based detection and fluorescent protein fusions

    • Employ multiple microscopy techniques (confocal, TIRF, super-resolution)

  • Control experiments to identify artifacts:

    • Test for tag interference by comparing different tag sizes and types

    • Use untagged protein detection when possible

    • Perform rescue experiments with wild-type protein

  • Consider developmental and physiological context:

    • Examine localization across different developmental stages

    • Test under various stimulation conditions

    • Compare results in different genetic backgrounds

  • Quantitative analysis framework:

    • Develop objective measurement criteria

    • Use automated image analysis to reduce bias

    • Implement statistical methods appropriate for the data distribution

  • Reconciliation strategies for contradictory models:

    • Develop testable hypotheses that could explain apparent contradictions

    • Consider cell-to-cell variability and heterogeneity in responses

    • Examine if different stimuli or conditions could explain different observations

How can single-cell transcriptomics inform our understanding of lrlA's role in cell differentiation?

Single-cell transcriptomics offers powerful insights into lrlA's role in Dictyostelium differentiation:

  • Experimental design considerations:

    • Capture cells across developmental time points (0, 6, 12, 18, 24 hours)

    • Compare wild-type, lrlA-knockout, and lrlA-overexpression strains

    • Include relevant developmental markers as internal controls

  • Technical approach:

    • Droplet-based single-cell RNA-seq for high-throughput analysis

    • SMART-seq2 for deeper coverage of transcripts

    • Spatial transcriptomics to preserve positional information in multicellular structures

  • Data analysis framework:

    • Trajectory inference to map developmental paths

    • Differential expression analysis between cell populations

    • Correlation analysis between lrlA and known developmental regulators

  • Integration with other data types:

    • Connect transcriptomic changes with observed phenotypes

    • Correlate with proteomic data when available

    • Map findings to known signaling networks

This approach can reveal if lrlA expression correlates with specific cell fates, similar to how RasD expression in Dictyostelium has been shown to bias cells toward prestalk cell fate . Such analysis could identify gene expression signatures associated with high or low lrlA expression, providing insights into its downstream effects.

How does Dictyostelium lrlA compare structurally and functionally to mammalian latrophilins?

A systematic comparison between Dictyostelium lrlA and mammalian latrophilins reveals important structural and functional insights:

FeatureDictyostelium lrlAMammalian LatrophilinsSignificance
Domain architecture[Based on sequence analysis]GPCR core with adhesion domainsConserved elements indicate essential functions
G-protein coupling[To be determined]Primarily Gαo, GαqDivergence suggests specialized signaling
Tissue expressionThroughout developmentEnriched in brain tissueFunctional specialization during evolution
Ligand specificity[To be determined]Teneurins, FLRTs, neurexinsReflects distinct biological roles
Signaling outcomes[To be determined]Calcium signaling, exocytosisMay reveal ancestral signaling mechanisms

When analyzing sequence conservation, focus on:

  • Transmembrane domains that form the ligand-binding pocket

  • Intracellular loops that interact with G-proteins and other signaling components

  • Extracellular domains that mediate adhesion functions

Functional complementation experiments can determine if lrlA can partially rescue phenotypes in mammalian cells lacking latrophilins, providing insights into evolutionary conservation of core functions.

What methodologies can determine if lrlA plays a role in Dictyostelium's response to bacterial pathogens?

To investigate lrlA's potential role in bacterial sensing or response:

  • Transcriptional response analysis:

    • Compare RNA-seq profiles between wild-type and lrlA-knockout Dictyostelium when exposed to different bacterial species

    • Dictyostelium shows highly specific transcriptional responses to different bacteria , and lrlA might be involved in detecting bacterial signals

  • Phagocytosis and bacterial killing assays:

    • Quantify ingestion rates using fluorescently labeled bacteria

    • Measure bacterial survival within Dictyostelium phagosomes

    • Compare these processes between wild-type and lrlA-modified strains

  • Chemotaxis experiments:

    • Test if lrlA-knockout affects directed migration toward bacterial products

    • While folate is a known bacterial chemoattractant, it elicits a distinct transcriptional response compared to whole bacteria , suggesting multiple sensing mechanisms

  • Host-pathogen interaction models:

    • Use pathogenic bacteria (like Mycobacterium marinum) to test if lrlA influences susceptibility

    • Examine if lrlA affects the transcriptional response to pathogenic versus non-pathogenic bacteria

Since Dictyostelium amoebae respond in highly specific ways to different bacterial species , determining if lrlA contributes to this specificity would provide important insights into its biological function.

How can I overcome common challenges in expressing and purifying functional recombinant lrlA?

Common challenges and their solutions in lrlA expression and purification:

  • Low expression levels:

    • Optimize codon usage for Dictyostelium

    • Test different promoters (act15, gpdA) and regulatory elements

    • Consider using expression enhancers like chaperon co-expression

    • Implement inducible expression systems to minimize toxicity

  • Protein aggregation:

    • Screen multiple detergents and lipid environments

    • Optimize solubilization conditions (temperature, time, detergent:protein ratio)

    • Consider fusion partners that enhance solubility (MBP, SUMO)

    • Test expression at lower temperatures to slow folding

  • Loss of function during purification:

    • Include stabilizing ligands throughout purification

    • Minimize exposure to harsh conditions (extreme pH, high salt)

    • Use gentle elution methods for affinity chromatography

    • Verify function at each purification step with activity assays

  • Troubleshooting decision tree:

    • If no expression detected: Check transcript levels, adjust vector design

    • If protein expressed but insoluble: Modify detergent conditions, try fusion tags

    • If protein purified but inactive: Review buffer composition, add stabilizers

    • If yield insufficient: Scale up culture volume, optimize growth conditions

What controls are essential when designing experiments to study lrlA function?

Essential controls for rigorous lrlA functional studies:

  • Genetic controls:

    • Complete knockout strains (lrlA-)

    • Rescue experiments with wild-type lrlA

    • Strains expressing catalytically inactive mutants

    • Overexpression strains to test dose-dependent effects

  • Experimental design controls:

    • Time course experiments to capture dynamic responses

    • Dose-response relationships for any treatment

    • Multiple independent clones to account for clonal variation

    • Growth conditions standardized across experiments

  • Technical controls:

    • For immunoblotting: Loading controls, antibody specificity validation

    • For microscopy: Autofluorescence controls, bleed-through controls

    • For functional assays: Positive controls with known activators

    • For phenotypic analysis: Multiple parameters quantified objectively

  • Validation across methods:

    • Confirm key findings with orthogonal techniques

    • Use both tagged and untagged versions where possible

    • Compare results in different genetic backgrounds

    • Validate in both laboratory and native strains of Dictyostelium

Implementing these controls ensures that observed phenotypes are specifically attributable to lrlA rather than experimental artifacts or secondary effects.

How might single-molecule techniques advance our understanding of lrlA dynamics and interactions?

Single-molecule approaches offer unprecedented insights into lrlA biology:

  • Single-molecule tracking:

    • Visualize diffusion dynamics of individual lrlA molecules in the membrane

    • Measure residence times in signaling complexes

    • Detect transient conformational states using FRET pairs

    • Compare dynamics before and after ligand stimulation

  • Super-resolution microscopy:

    • Resolve nanoscale organization of lrlA in the membrane

    • Detect co-localization with signaling partners at molecular resolution

    • Map the spatial organization of signaling clusters

    • Track conformational changes upon activation

  • Force spectroscopy:

    • Measure binding/unbinding forces between lrlA and ligands

    • Characterize mechanical properties of individual receptor molecules

    • Detect force-induced conformational changes

  • Single-molecule sequencing applications:

    • Analyze transcriptional heterogeneity of lrlA expression

    • Link genetic variants to functional differences

    • Map epigenetic modifications affecting lrlA expression

These approaches can reveal mechanisms similar to those observed with G-protein dynamics in Dictyostelium, where FRET measurements have shown how receptor activation affects G-protein localization and interaction .

What are the most promising approaches for developing lrlA as a tool for biomedical research?

Leveraging lrlA for biomedical applications:

  • Drug discovery platforms:

    • Develop high-throughput screening systems using lrlA-based biosensors

    • Create chimeric receptors combining mammalian and Dictyostelium domains

    • Use evolutionary conservation to identify druggable pockets

  • Disease modeling applications:

    • Engineer Dictyostelium strains expressing human disease-associated variants

    • Similar approaches have been successful for studying neurodegenerative disease genes in Dictyostelium

    • Use as a simplified system to deconvolute complex signaling networks

  • Synthetic biology tools:

    • Design lrlA-based optogenetic tools for controlling cell behavior

    • Create synthetic signaling circuits with programmable responses

    • Develop biosensors for detecting specific environmental signals

  • Biomedical research advantages:

    • Rapid screening capability due to Dictyostelium's short doubling time

    • Simplified genetic manipulation in a haploid organism

    • Conserved signaling pathways relevant to human disease

    • Ethical and practical advantages over mammalian models for initial screens

The technical advantages of Dictyostelium as a model organism, including its ease of culture, genetic tractability, and conservation of many human disease genes , make it an attractive system for developing these biomedical research tools.

What are the key considerations for ensuring reproducibility in lrlA research?

Ensuring reproducibility in lrlA research requires attention to multiple factors:

  • Standardized protocols:

    • Detailed methods sections with precise experimental conditions

    • Standardized growth conditions for Dictyostelium cultures

    • Consistent handling of cells during development and differentiation

    • Defined criteria for phenotypic assessment

  • Strain management:

    • Maintain proper strain documentation and validation

    • Regular verification of genetic modifications

    • Use of strain repositories for long-term storage

    • Distribution of strains to other laboratories upon request

  • Data reporting standards:

    • Complete reporting of all experimental conditions and controls

    • Sharing of raw data when possible

    • Full disclosure of sample sizes and statistical methods

    • Reporting of negative or contradictory results

  • Methodological transparency:

    • Detailed description of image analysis procedures

    • Publication of analysis code and algorithms

    • Clear criteria for inclusion/exclusion of data points

    • Blinded analysis where applicable

These practices align with the rigorous experimental approaches used in studies of G-protein dynamics , developmental processes , and transcriptional responses in Dictyostelium, ensuring that findings related to lrlA can be validated and extended by the broader research community.

How can researchers effectively collaborate across disciplines to advance lrlA research?

Effective interdisciplinary collaboration strategies:

  • Establish common language and goals:

    • Develop shared terminology across disciplines

    • Define clear research questions accessible to all team members

    • Create integrated experimental workflows

    • Implement regular cross-disciplinary meetings

  • Leverage complementary expertise:

    • Cell biologists: Provide insights into Dictyostelium biology and development

    • Structural biologists: Contribute expertise in membrane protein analysis

    • Computational scientists: Assist with modeling and data analysis

    • Systems biologists: Help integrate findings into signaling networks

  • Technology integration framework:

    • Establish compatible data formats across platforms

    • Develop integrated analysis pipelines

    • Create shared resources and protocols

    • Implement version control for collaborative analysis

  • Knowledge dissemination strategies:

    • Joint publications targeting diverse audiences

    • Cross-training of students and postdocs

    • Development of shared resources and databases

    • Open access to protocols, reagents, and data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.