Recombinant Dictyostelium discoideum Lysosome membrane protein 2-A (lmpA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lmpA; DDB_G0267406; Lysosome membrane protein 2-A; Lysosome membrane protein II-1; LIMP II-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-779
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
lmpA
Target Protein Sequence
MVKRGCCHRKMVNHKGCLVSGIFLAVIGAVLFILAFALLPHLINQTTQNAVIQAVIVDST SSQRYNDWAGQQSIENYYQQYFYAWNLTNPNEFLNGSIPIFETVGPFNYKYEFNFSNVTF QDGGNLATYTQSKSFIYQSDMSPNDPNEIMITNINPAYLGLMFQLAPNAELLDNMPAENL LIALSGCGQMRLFLEYLSSDNFTNIVYFTQNPKLYQEQYLNILKSLNGDEQYFYQQWANA TSIPQKGNGWYGMLVSSVNNNNESSNISILSAKLLFNSSNENSILNQEIGSTLWINALLG DKTSITVLTSELQLTVDQIDMILNWWLNDFSKVYTESYVNEICDIPDISMLGVCQFVTGN ALNGRSISNYTFLTQPFDQGPIEIPLLYQSIGIDVKLSVSVQQAYKSLFNESDSNSILNL NGLVNFLTASKSFDTFKQYNVTLFDAIKIIGYATAELYEQYNKPTILGLYEKYGGLIVTR SMDDWLWNCQDGILDYLGVDQPCALQQNNTVNKPSTIFTGQQDLSMTNQIFEFQEQTFLT CWNGSVQVEGFTESGQFPPLQSDPPQTMTLFEENVIRPVQLELSGDSQVQGIDTKRYYLV NNSFPISTTFKTTIPGFANLTDIQNLPIYVSLWDMYEVPPQYSSNNLQGLNQTYQSAQVP LDLEPITGNALYYNLKLQINLAIPEFSNWFSSNSTFKNMKSNVFYPILKIGQTATPSQSN IDLLNSQFKLIKILGFVPVIVVSIIGGIILIAGISMFAFGFKKLRQQKQQGYQAIINNE
Uniprot No.

Target Background

Function
This protein may function as a lysosomal receptor, potentially involved in macropinocytosis and fluid-phase exocytosis. It binds to the anionic phospholipid phosphoinositol 4,5-bisphosphate, exhibiting minimal binding to phosphatidylcholine and weak binding to phosphatidylserine.
Database Links
Protein Families
CD36 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein.

Q&A

What is LmpA and what is its functional significance in Dictyostelium discoideum?

LmpA is a lysosomal membrane protein in Dictyostelium discoideum that functions as a homologue to the mammalian lysosomal membrane protein LIMP-2 (also known as SCARB2). This protein plays critical roles in multiple cellular processes including phagocytosis and phagolysosome biogenesis, which are essential for the organism's ability to take up, kill, and digest microbes .

The functional significance of LmpA lies in its regulation of actin-dependent processes such as particle uptake, cellular spreading, and motility. Additionally, it is crucial for phagosomal acidification and proteolysis, which are key steps in the digestion of ingested particles and pathogens . The conservation of these functions across evolutionary distance from D. discoideum to mammals highlights the importance of this protein family in fundamental cellular processes related to immunity and cellular homeostasis .

How does LmpA relate to mammalian LIMP-2 in terms of structure and function?

LmpA in Dictyostelium discoideum is a homologue of the mammalian lysosomal integral membrane protein 2 (LIMP-2), which belongs to the class B scavenger receptor family. While specific structural details are not fully elaborated in the provided research, functional studies indicate significant conservation of key roles between these proteins .

The functional homology is evident in several aspects:

  • Both proteins are involved in lysosomal enzyme trafficking and biogenesis

  • They contribute to host cell defense mechanisms against intracellular pathogens

  • Both play roles in phagocytic processes that are essential for immune function

This functional conservation is particularly noteworthy given that phagocytic mechanisms are extremely conserved throughout evolution from early eukaryotes to specialized immune cells in mammals . The conservation of LmpA functions in D. discoideum makes it a valuable model for understanding the roles of LIMP-2 in human health and disease, particularly in contexts of lysosomal disorders and immune responses to pathogens .

What phenotypes are observed in lmpA knockdown mutants of D. discoideum?

The lmpA knockdown mutants in Dictyostelium discoideum exhibit several distinct phenotypes that highlight the protein's importance in cellular function:

  • Impaired actin-dependent processes:

    • Reduced efficiency in particle uptake

    • Defects in cellular spreading

    • Decreased motility capabilities

  • Compromised phagolysosome function:

    • Severe impairment in phagosomal acidification

    • Reduced proteolytic activity within phagosomes

    • Inefficient degradation of ingested particles

  • Increased susceptibility to bacterial infection:

    • Higher vulnerability to infection with Mycobacterium marinum, a close relative of the human pathogen Mycobacterium tuberculosis

    • Reduced ability to control bacterial replication after uptake

These phenotypes collectively demonstrate that LmpA is essential for normal phagocytic function and host defense capabilities in D. discoideum, providing important insights into the molecular underpinnings of these processes .

What are the recommended methods for generating recombinant LmpA protein from D. discoideum?

For generating recombinant LmpA protein from Dictyostelium discoideum, researchers should consider the following methodological approach:

  • Vector construction:

    • Amplify the lmpA gene from D. discoideum genomic DNA or cDNA using PCR with high-fidelity polymerase

    • Clone the amplified sequence into an appropriate expression vector, preferably one with an inducible promoter system and affinity tag (e.g., His-tag or GST-tag)

    • For expression in D. discoideum itself, vectors utilizing the actin 15 promoter have proven effective

  • Expression systems options:

    • Homologous expression in D. discoideum: Provides proper folding and post-translational modifications

    • Heterologous expression in bacteria (E. coli): Higher yield but potential issues with proper folding of membrane proteins

    • Eukaryotic expression systems (insect cells, mammalian cells): Better for maintaining functionality of complex membrane proteins

  • Purification strategy:

    • If expressed with affinity tags, use corresponding affinity chromatography (nickel columns for His-tagged proteins)

    • For membrane proteins like LmpA, include detergent solubilization steps using mild detergents (e.g., n-dodecyl-β-D-maltoside)

    • Consider size exclusion chromatography as a final purification step to ensure homogeneity

  • Validation methods:

    • Western blot with anti-LmpA antibodies

    • Mass spectrometry to confirm protein identity

    • Functional assays to verify activity of the recombinant protein

While the search results don't provide a specific protocol for LmpA recombinant production, these methods are based on standard approaches for similar proteins, taking into account the membrane-associated nature of LmpA and its functional importance in cellular processes .

How can researchers effectively generate and validate lmpA knockdown mutants?

To generate and validate effective lmpA knockdown mutants in Dictyostelium discoideum, researchers should follow these methodological steps:

  • Knockdown strategies:

    • RNA interference (RNAi): Design specific siRNAs targeting lmpA mRNA

    • Antisense RNA: Create constructs expressing antisense RNA complementary to lmpA transcripts

    • CRISPR/Cas9: Design guide RNAs targeting the lmpA gene for precise gene editing

  • Transformation methods:

    • Electroporation of D. discoideum cells with knockdown constructs

    • Selection of transformants using appropriate antibiotic resistance markers

    • Isolation of individual clones for further validation

  • Validation of knockdown efficiency:

    • Quantitative RT-PCR: Measure lmpA mRNA levels compared to wild-type controls

    • Western blot analysis: Assess LmpA protein levels using specific antibodies

    • Immunofluorescence microscopy: Visualize reduction in LmpA localization patterns

  • Functional validation methods:

    • Phagocytosis assays: Test uptake of fluorescent particles or bacteria

    • Cellular motility assays: Analyze cell movement and spreading capabilities

    • Phagosomal acidification measurement: Use pH-sensitive fluorescent probes

    • Bacterial infection studies: Challenge with M. marinum and assess bacterial survival/replication

  • Complementation studies:

    • Reintroduce wild-type lmpA into knockdown mutants to confirm phenotype specificity

    • Use expression constructs with regulatable promoters to achieve controlled expression levels

Successful knockdown mutants should show significant reduction in LmpA protein levels (ideally >70-80% reduction) and display the characteristic phenotypes described in the literature, including impaired phagocytosis, defective phagosomal acidification, and increased susceptibility to bacterial infection .

What methods are used to assess phagolysosome biogenesis and function in lmpA studies?

Assessing phagolysosome biogenesis and function in lmpA studies requires a combination of experimental approaches that evaluate various aspects of the phagocytic pathway. Based on established methodologies, researchers employ the following techniques:

  • Phagosomal acidification measurements:

    • pH-sensitive fluorescent particles: Use particles labeled with pH-sensitive dyes (e.g., pHrodo)

    • Dual-fluorescence ratiometric imaging: Employ particles labeled with pH-sensitive and pH-insensitive fluorophores

    • LysoTracker staining: Monitor acidification of phagosomal compartments

    • Quantitative assessment of fluorescence intensity changes over time to track acidification kinetics

  • Phagosomal proteolytic activity:

    • Fluorogenic substrates: Use particles coupled with quenched fluorescent protease substrates

    • DQ-BSA assay: Monitor proteolysis through unquenching of fluorescence

    • Pulse-chase analysis: Track degradation of labeled phagocytosed particles over time

  • Phagolysosome fusion assessment:

    • Immunofluorescence co-localization: Track co-localization of phagosomal markers with lysosomal markers

    • Live cell imaging: Monitor recruitment of fluorescently tagged lysosomal proteins to phagosomes

    • Electron microscopy: Visualize ultrastructural features of phagolysosomes

  • Lysosomal enzyme trafficking:

    • Subcellular fractionation: Isolate phagosomal fractions and measure lysosomal enzyme activity

    • Activity-based protein profiling: Use activity-based probes to monitor active lysosomal enzymes

  • Actin cytoskeleton dynamics:

    • Fluorescent phalloidin staining: Visualize F-actin distribution during phagocytosis

    • Live imaging with fluorescent actin probes: Monitor actin rearrangements during particle uptake

    • Quantitative analysis of phagocytic cup formation and closure

These methodologies allow researchers to comprehensively assess the impact of LmpA on various aspects of phagolysosome biogenesis and function, from initial particle uptake through phagosome maturation to eventual digestion of phagocytosed material .

How does LmpA in D. discoideum contribute to our understanding of host-pathogen interactions?

LmpA in Dictyostelium discoideum provides crucial insights into host-pathogen interactions through several key mechanisms:

  • Model for mycobacterial infection:

    • LmpA knockdown mutants show increased susceptibility to Mycobacterium marinum infection, a close relative of the human pathogen M. tuberculosis

    • This directly demonstrates the protein's role in host defense against pathogenic mycobacteria

    • The findings have translational relevance for understanding tuberculosis pathogenesis in humans

  • Conservation of phagocytic mechanisms:

    • The mechanisms of phagocytosis and bacterial digestion are extremely conserved evolutionarily

    • Studies in D. discoideum reveal fundamental processes likely applicable to mammalian immune cells

    • The conservation of LmpA functions between D. discoideum and mammalian LIMP-2 reinforces the relevance of these findings

  • Insights into phagosomal maturation:

    • LmpA regulates critical steps in phagosomal acidification and proteolysis

    • These processes are primary determinants of a host cell's ability to kill intracellular pathogens

    • Understanding how pathogens might evade or subvert these processes informs strategies to combat infection

  • Link to lysosomal trafficking:

    • LmpA's role in lysosomal enzyme trafficking parallels mammalian LIMP-2 function

    • This connection illuminates how defects in lysosomal machinery can compromise immunity

    • The interplay between lysosomal function and pathogen clearance becomes evident

  • Experimental advantages:

    • D. discoideum offers a haploid genome and genetic/biochemical accessibility

    • These features allow detailed dissection of host-pathogen interactions at a molecular level

    • The InfectChip platform provides technical advantages for studying infection dynamics in controlled environments

The study of LmpA thus serves as a versatile experimental model that bridges fundamental cell biology with infection biology, offering insights that would be more challenging to obtain directly from mammalian systems .

What is the relationship between LmpA and actin-dependent cellular processes?

The relationship between LmpA and actin-dependent cellular processes in Dictyostelium discoideum involves complex regulatory mechanisms that impact multiple aspects of cell function:

  • Influence on phagocytic uptake:

    • LmpA knockdown mutants exhibit significant defects in particle uptake processes

    • Phagocytosis requires precise coordination of actin cytoskeleton remodeling

    • LmpA appears to regulate the actin rearrangements necessary for phagocytic cup formation and closure

  • Effects on cell motility and spreading:

    • Mutants lacking functional LmpA show impaired cellular spreading capabilities

    • Cell motility, which relies on dynamic actin reorganization, is compromised

    • These phenotypes indicate LmpA's influence extends beyond phagocytosis to general actin-mediated cellular behaviors

  • Molecular mechanisms:

    • While the exact signaling pathway connecting LmpA to actin dynamics remains to be fully characterized, several possibilities exist:

      • Regulation of small GTPases that control actin polymerization

      • Influence on phosphoinositide metabolism at membrane interfaces

      • Potential interactions with actin-binding proteins or their regulators

  • Relationship to developmental processes:

    • D. discoideum relies on actin-dependent motility during its developmental cycle

    • Although not directly addressed in the search results, the conservation of LmpA function suggests potential roles in coordination of collective cell movement during aggregation

  • Comparison with mammalian systems:

    • The involvement of LmpA in actin-dependent processes parallels findings in mammalian systems

    • This suggests evolutionary conservation of mechanisms linking membrane trafficking components to cytoskeletal regulation

The multifaceted relationship between LmpA and actin-dependent processes represents a significant area for further research, particularly in understanding how membrane trafficking components like lysosomal proteins exert influence over cytoskeletal dynamics and related cellular behaviors .

How does LmpA function compare to LmpB in D. discoideum, and what are the implications for understanding scavenger receptor evolution?

The functional comparison between LmpA and LmpB in Dictyostelium discoideum provides important insights into the evolution of scavenger receptors:

  • Distinct functional homologies:

    • LmpA functions as a homologue of mammalian LIMP-2 (SCARB2)

    • LmpB acts as a functional homologue of mammalian CD36

    • Both belong to the class B scavenger receptor family but have diverged in their specialized roles

  • Specialized roles in phagocytosis:

    • LmpA has a broader role in phagocytosis and phagolysosome biogenesis

    • LmpB specifically mediates the uptake of mycobacteria, demonstrating functional specialization

    • This suggests an early evolutionary divergence in receptor specificity for different targets

  • Evolutionary implications:

    • LmpA and LmpB represent ancestors of the family that includes mammalian LIMP-2 and CD36

    • Their presence in D. discoideum indicates that the functional specialization of these receptors predates the evolution of metazoans

    • The conservation of these proteins highlights their fundamental importance in cellular function

  • Structural-functional relationships:

    • The maintenance of distinct functions despite evolutionary distance suggests critical structural determinants

    • These structural elements likely define the binding specificities and downstream signaling capabilities

    • Understanding these relationships can inform structure-based drug design targeting mammalian counterparts

  • Implications for host defense evolution:

    • The specialized functions of LmpA and LmpB in D. discoideum suggest that the division of labor between different scavenger receptors is an ancient evolutionary adaptation

    • This specialization likely provided advantages in distinguishing between different types of microorganisms

    • The conservation of these functions points to their fundamental importance in host defense mechanisms

This comparative analysis of LmpA and LmpB functions provides a unique window into the evolutionary history of scavenger receptors and their diversification from primitive phagocytic systems to the specialized immune receptors found in mammals .

What methodologies are most effective for studying LmpA localization in D. discoideum cells?

For studying LmpA localization in Dictyostelium discoideum cells, researchers should employ multiple complementary approaches to ensure robust and accurate results:

  • Fluorescent protein fusion techniques:

    • GFP/RFP fusion constructs: Create N- or C-terminal fluorescent protein fusions with LmpA

    • Expression systems: Use inducible promoters to control expression levels and avoid artifacts

    • Live cell imaging: Monitor dynamic localization patterns in real-time

    • Validation: Confirm functionality of fusion proteins through rescue experiments in lmpA knockdown backgrounds

  • Immunofluorescence microscopy:

    • Fixation protocols: Test multiple fixation methods (paraformaldehyde, methanol) to preserve structure

    • Antibody selection: Use specific anti-LmpA antibodies or epitope tags if direct antibodies unavailable

    • Co-localization studies: Combine with markers for specific compartments (lysosomes, phagosomes, endosomes)

    • Quantitative analysis: Employ Pearson's correlation coefficient or Manders' overlap coefficient for co-localization assessment

  • Subcellular fractionation approaches:

    • Differential centrifugation: Separate cellular compartments based on density and size

    • Sucrose gradient fractionation: Achieve finer separation of membrane-bound compartments

    • Western blot analysis: Detect LmpA in different fractions alongside compartment-specific markers

    • Enzyme activity assays: Correlate LmpA presence with lysosomal enzyme activities

  • Advanced microscopy techniques:

    • Super-resolution microscopy (STED, PALM, STORM): Overcome diffraction limit for precise localization

    • Correlative light and electron microscopy (CLEM): Combine fluorescence with ultrastructural information

    • Lattice light-sheet microscopy: Allow long-term imaging with minimal phototoxicity

  • Dynamic localization studies:

    • Pulse-chase experiments: Track movement of LmpA through cellular compartments over time

    • Photoactivatable/photoconvertible tags: Follow specific pools of LmpA proteins

    • Optogenetic approaches: Control LmpA localization or function with light-sensitive domains

By combining these methodological approaches, researchers can comprehensively characterize the spatiotemporal dynamics of LmpA localization under various conditions, particularly during phagocytosis and infection processes, providing insights into its functional roles .

What are the key considerations when interpreting bacterial infection studies in lmpA mutants?

  • Separating direct from indirect effects:

    • Phagocytic uptake vs. intracellular survival: Determine whether increased bacterial burden results from enhanced uptake or reduced killing

    • Acidification defects: Consider whether impaired bacterial clearance stems directly from acidification defects or from broader phagolysosomal dysfunction

    • Secondary consequences: Assess whether observed phenotypes are direct consequences of LmpA absence or downstream effects

  • Bacterial strain considerations:

    • Pathogen-specific effects: The lmpA mutant shows specific susceptibility to Mycobacterium marinum, which may not extend to all bacterial species

    • Virulence factors: Consider how bacterial virulence mechanisms might interact differently with wildtype versus lmpA mutant cells

    • Growth conditions: Bacterial growth phase and culture conditions can influence infection outcomes

  • Experimental design factors:

    • Infection protocols: Standardize multiplicity of infection (MOI), infection duration, and washing steps

    • Quantification methods: Consider limitations of different bacterial quantification approaches (CFU counting, fluorescence-based methods)

    • Temporal dynamics: Assess infection at multiple timepoints to distinguish between effects on initial uptake, early killing, and long-term containment

  • Control considerations:

    • Genetic background effects: Include appropriate parental strains as controls

    • Complementation experiments: Verify phenotype rescue with wildtype LmpA expression

    • Domain-specific mutants: Use targeted mutations to dissect which LmpA domains contribute to specific functions

  • Physiological relevance:

    • Growth conditions: Consider how laboratory growth conditions might affect host-pathogen interactions

    • Environmental factors: Temperature, pH, and nutrient availability can influence infection outcomes

    • Evolutionary context: Interpret findings in light of the natural ecological relationships between D. discoideum and environmental bacteria

  • Translational considerations:

    • Conservation of mechanisms: Evaluate how findings might translate to mammalian systems

    • Pathogen-specific pathways: Consider whether identified mechanisms are relevant to human pathogens like M. tuberculosis

    • Therapeutic implications: Assess potential for targeting homologous pathways in human disease contexts

By carefully considering these factors, researchers can extract maximum value from infection studies in lmpA mutants while avoiding overinterpretation or overlooking important aspects of the host-pathogen interaction .

How can researchers differentiate between direct and indirect effects of LmpA on phagocytosis and phagosomal maturation?

Differentiating between direct and indirect effects of LmpA on phagocytosis and phagosomal maturation requires sophisticated experimental approaches and careful data interpretation:

  • Domain-specific mutations and truncations:

    • Create LmpA variants with mutations in specific functional domains

    • Express these in lmpA knockdown backgrounds to determine which domains rescue which phenotypes

    • This approach can separate functions that are mechanistically distinct

  • Temporal analysis of phagocytosis stages:

    • High-resolution time-lapse imaging: Track distinct phases of phagocytosis (binding, cup formation, internalization)

    • Synchronized phagocytosis assays: Use temperature shifts or centrifugation to synchronize particle uptake

    • Pulse-chase approaches: Follow maturation of a cohort of phagosomes over time

    • These techniques help determine at which specific stage LmpA exerts its effects

  • Biochemical interaction studies:

    • Co-immunoprecipitation: Identify direct binding partners of LmpA

    • Proximity labeling techniques: Use BioID or APEX2 fusions to identify proteins in close proximity to LmpA

    • Interactome mapping: Compare interaction networks in different phagosomal maturation stages

    • These approaches help establish direct mechanistic links to specific processes

  • Rescue experiments with specific pathway components:

    • Express downstream components of affected pathways in lmpA mutants

    • If expression of these components rescues specific phenotypes, it suggests LmpA's effect is mediated through that pathway

    • This approach helps establish hierarchical relationships in signaling pathways

  • Conditional and acute inactivation approaches:

    • Use inducible knockdown/knockout systems to acutely remove LmpA

    • Employ rapid chemical inhibition or optogenetic inactivation techniques

    • Acute inactivation helps distinguish primary effects from adaptive or compensatory responses

  • Comparative analysis with other mutants:

    • Compare lmpA phenotypes with mutants affecting known phagosomal maturation regulators

    • Establish epistatic relationships through double mutant analysis

    • Such comparisons help place LmpA within established pathways

  • Cross-species complementation:

    • Express mammalian LIMP-2 in lmpA mutants to determine functional conservation

    • Domain-swap experiments between LmpA and mammalian homologues

    • These approaches help identify evolutionarily conserved direct functions

By systematically applying these experimental strategies, researchers can build a comprehensive understanding of LmpA's direct mechanistic roles versus its indirect effects on phagocytosis and phagosomal maturation pathways .

What are promising research directions for understanding LmpA's role in host defense mechanisms?

Several promising research directions could advance our understanding of LmpA's role in host defense mechanisms:

  • Comprehensive mapping of the LmpA interactome:

    • Apply proximity labeling techniques (BioID, APEX) to identify LmpA-associated proteins during different stages of phagocytosis

    • Use quantitative proteomics to track dynamic changes in these interactions during infection

    • Correlate interactome changes with specific pathogen challenges to identify pathogen-specific responses

  • Structure-function analysis of LmpA domains:

    • Determine the crystal or cryo-EM structure of LmpA to identify functional domains

    • Create a library of domain-specific mutations to dissect functional roles

    • Compare structural features with mammalian LIMP-2 to understand evolutionary conservation of function

  • Investigation of LmpA in pathogen-specific responses:

    • Expand infection studies beyond M. marinum to diverse bacterial and fungal pathogens

    • Identify pathogen factors that specifically interact with or are affected by LmpA

    • Explore potential roles in viral recognition or restriction

  • Interplay between LmpA and LmpB in mycobacterial infections:

    • Generate and characterize lmpA/lmpB double mutants

    • Determine whether these proteins function in the same or parallel pathways

    • Investigate potential coordinated regulation of these receptors during infection

  • Role in innate immune signaling pathways:

    • Investigate whether LmpA influences signaling cascades beyond its direct roles in phagocytosis

    • Examine potential connections to conserved immune signaling pathways

    • Study how LmpA might mediate communication between the phagosome and other cellular compartments

  • Translational applications:

    • Develop high-throughput screening approaches using lmpA mutants to identify compounds that rescue phagosomal function

    • Explore whether modulating LIMP-2 activity in mammalian systems can enhance antimicrobial responses

    • Investigate connections between LmpA/LIMP-2 functions and human infectious disease susceptibility

  • Systems biology approaches:

    • Apply multi-omics techniques (transcriptomics, proteomics, metabolomics) to comprehensively characterize lmpA mutant phenotypes

    • Develop computational models integrating LmpA functions into broader networks of host defense

    • Use machine learning approaches to identify subtle patterns in infection dynamics

These research directions could significantly advance our understanding of this evolutionarily conserved protein's role in host defense mechanisms, potentially revealing new therapeutic targets for enhancing immunity against intracellular pathogens .

What technical innovations could advance studies of recombinant LmpA in cellular and biochemical assays?

Several technical innovations could significantly advance studies of recombinant LmpA in cellular and biochemical assays:

  • Advanced protein expression systems:

    • Cell-free expression systems: Develop optimized cell-free systems for membrane protein production

    • Nanodiscs and membrane mimetics: Incorporate LmpA into membrane mimetics for structural and functional studies

    • Split protein complementation: Create split LmpA constructs for detecting protein-protein interactions in living cells

    • These approaches would facilitate production of functional recombinant protein for biochemical studies

  • High-resolution imaging technologies:

    • Super-resolution live-cell imaging: Apply techniques like lattice light-sheet microscopy with adaptive optics

    • Correlative light and electron microscopy (CLEM): Combine fluorescence and ultrastructural information

    • Expansion microscopy: Physical expansion of samples for improved resolution of subcellular structures

    • These methods would allow detailed visualization of LmpA dynamics during phagocytosis and infection

  • Single-molecule approaches:

    • Single-molecule tracking: Follow individual LmpA molecules in living cells to determine mobility and clustering

    • Force spectroscopy: Measure binding forces between LmpA and its interaction partners

    • Single-molecule FRET: Detect conformational changes in LmpA during functional cycles

    • These techniques would provide insights into molecular mechanisms of LmpA function

  • Microfluidic and organ-on-chip technologies:

    • Microfluidic infection models: Create devices for controlled infection studies with precise temporal control

    • Gradient generation: Study LmpA's role in directed cell migration and chemotaxis

    • High-throughput phenotypic screening: Develop platforms for testing multiple conditions simultaneously

    • These approaches would enable more physiologically relevant studies of LmpA function

  • Genome engineering innovations:

    • Base editing and prime editing: Make precise modifications to LmpA without double-strand breaks

    • Inducible degradation systems: Create tools for rapid LmpA protein depletion

    • Optogenetic control: Develop light-controlled LmpA variants for temporal and spatial regulation

    • These methods would allow more sophisticated manipulation of LmpA function in vivo

  • Structural biology approaches:

    • Cryo-electron microscopy: Determine LmpA structure in different functional states

    • Hydrogen-deuterium exchange mass spectrometry: Map conformational dynamics and binding interfaces

    • Cross-linking mass spectrometry: Identify interaction surfaces between LmpA and binding partners

    • These techniques would provide detailed structural insights into LmpA function

  • In silico approaches:

    • Molecular dynamics simulations: Model LmpA interactions with membranes and binding partners

    • AI-based structure prediction: Apply AlphaFold-like approaches to model LmpA complexes

    • Systems biology modeling: Integrate LmpA into broader cellular pathway models

    • These computational approaches would complement experimental studies

Implementation of these technical innovations would significantly enhance our ability to study LmpA function at molecular, cellular, and systems levels, potentially leading to breakthroughs in understanding its role in host defense mechanisms .

How might comparative studies between D. discoideum LmpA and mammalian LIMP-2 advance our understanding of lysosomal membrane protein evolution and function?

Comparative studies between D. discoideum LmpA and mammalian LIMP-2 offer significant potential to advance our understanding of lysosomal membrane protein evolution and function through several research approaches:

  • Evolutionary analysis of sequence conservation:

    • Phylogenetic mapping: Trace the evolutionary history of LmpA/LIMP-2 across species

    • Conservation analysis: Identify highly conserved residues as potential functional hotspots

    • Selection pressure analysis: Determine regions under positive or negative selection

    • These approaches would reveal the core functional elements maintained throughout evolution

  • Cross-species complementation experiments:

    • Expression of mammalian LIMP-2 in lmpA mutants: Test functional rescue capabilities

    • Domain swap experiments: Create chimeric proteins with domains from both species

    • Site-directed mutagenesis of conserved residues: Test functional importance of specific amino acids

    • These experiments would establish which functions have been conserved across evolution

  • Comparative structural biology:

    • Structure determination: Compare atomic structures of LmpA and LIMP-2

    • Conformational dynamics: Analyze differences in protein flexibility and conformational states

    • Ligand binding properties: Compare binding sites and affinities for shared ligands

    • These studies would reveal structural adaptations underlying functional conservation or divergence

  • Comparative interactome mapping:

    • Protein-protein interaction profiling: Compare binding partners between species

    • Temporal dynamics: Analyze how interactions change during cellular processes

    • Conservation of interaction networks: Identify core conserved interactions versus species-specific ones

    • These approaches would reveal how interaction networks have evolved

  • Comparative pathogen resistance mechanisms:

    • Infection models: Compare responses to the same pathogens between species

    • Pathogen evasion mechanisms: Identify how pathogens interact with LmpA versus LIMP-2

    • Host restriction factors: Determine whether either protein has evolved specialized pathogen resistance functions

    • These studies would illuminate evolutionary adaptations in host-pathogen interactions

  • Translational implications:

    • Disease-associated mutations: Test effects of human LIMP-2 disease mutations in D. discoideum

    • Drug screening: Use D. discoideum as a platform to identify compounds affecting conserved functions

    • Biomedical applications: Develop interventions targeting conserved mechanisms in human disease

    • These approaches would leverage evolutionary conservation for biomedical advancement

  • Systems-level comparative analysis:

    • Multi-omics profiling: Compare cellular responses to LmpA/LIMP-2 disruption across species

    • Network analysis: Identify conserved and divergent pathway arrangements

    • Functional adaptation: Analyze how similar functions are achieved through different molecular mechanisms

    • These studies would place protein function in broader cellular context

These comparative approaches would significantly enhance our understanding of how lysosomal membrane proteins have evolved while maintaining critical functions in cellular homeostasis and host defense across evolutionary distance, potentially revealing fundamental principles of protein evolution and cellular adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.