Recombinant Dictyostelium discoideum Membrane selenoprotein (msp)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
msp; DDB_G0277015; Membrane selenoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
msp
Target Protein Sequence
MSLFNLPKVDLGEDCEGGVUARPSSSSSSINNASDESTPLISKTNDEEKANIGISSTSNS PQEEQTKKPLFISILTLLISIPALVGSUCWPVLIASLSGVAVSAGSVELAHSLTFAITLS ILSNLAQYHFHKCKKRPSDRGHWIKFGPFYLTAIAVPLATFDILRHILVDNSIWTIHSFI SPAAYRPGCENENITCLSVMGWFSAIVFTYTGYACLLVGTIWAADLIPKIKKVWTQLRPS KKN
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are typically used for recombinant D. discoideum Membrane selenoprotein?

Escherichia coli (E. coli) is the predominant expression system for recombinant D. discoideum Membrane selenoprotein. The bacterial expression system allows for efficient production of the protein with an N-terminal His-tag for purification purposes. This approach enables researchers to obtain purified protein for functional and structural studies .

How does D. discoideum serve as a model organism for biomedical research?

Despite lacking a central nervous system, D. discoideum has emerged as a valuable model organism for studying various neurological disorders, including Alzheimer's disease, Parkinson's disease, Huntington's disease, neuronal ceroid lipofuscinoses, and lissencephaly . This unicellular eukaryote possesses highly conserved cellular processes that provide insights into key cellular abnormalities associated with these disorders, such as mitochondrial dysfunction and aberrant lysosomal activity .

The relevance of D. discoideum as a model system is demonstrated by its ability to express functional human proteins. For example, human Psen1 (presenilin 1) can rescue developmental defects in D. discoideum presenilin double mutants, confirming the functional homology between human and D. discoideum presenilin proteins . This makes D. discoideum particularly valuable for investigating protein function in a simplified cellular context.

What are the optimal conditions for storing and reconstituting recombinant D. discoideum Membrane selenoprotein?

Proper storage and reconstitution of recombinant D. discoideum Membrane selenoprotein are critical for maintaining its structural integrity and functional activity. The lyophilized protein should be stored at -20°C to -80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise protein stability .

For reconstitution, the following protocol is recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard)

  • Aliquot for long-term storage at -20°C/-80°C

The reconstituted protein is typically stable in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

What purification strategies yield the highest purity for recombinant D. discoideum Membrane selenoprotein?

The most effective purification strategy for recombinant D. discoideum Membrane selenoprotein leverages affinity chromatography using the N-terminal His-tag. This approach typically yields protein with greater than 90% purity as determined by SDS-PAGE . The purification workflow generally consists of:

  • Cell lysis under native or denaturing conditions depending on protein solubility

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin

  • Washing with increasing concentrations of imidazole to remove non-specifically bound proteins

  • Elution with high imidazole concentration

  • Buffer exchange to remove imidazole and concentrate the protein

  • Quality control by SDS-PAGE and potentially mass spectrometry

For membrane proteins like msp, additional considerations include the potential need for detergents to maintain solubility throughout the purification process. The choice of detergent can significantly impact the structural integrity and functional activity of the purified protein.

How can D. discoideum Membrane selenoprotein be utilized in neurological disorder research?

While D. discoideum Membrane selenoprotein (msp) itself has not been directly linked to neurological disorders in the literature provided, the D. discoideum model system offers several advantages for studying proteins implicated in such conditions. Researchers can use this system to:

  • Express and study human homologs of msp or other selenoproteins in D. discoideum to investigate their functions in a simplified cellular context

  • Investigate potential roles of selenoproteins in mitochondrial function and oxidative stress, which are key factors in many neurological disorders

  • Utilize D. discoideum's tractable genetic system for creating knockout or knockin mutants to study protein function

The D. discoideum model has already provided valuable insights into the function of presenilin proteins, which are implicated in Alzheimer's disease. For example, studies have shown that human presenilin proteins can functionally replace D. discoideum presenilin proteins, demonstrating the conservation of function across species .

Human GeneD. discoideum HomologueMutant StrainMulticellular PhenotypeMain Findings
LRRK2Roco genes (gbpC, qkgA, pats1, roco4-11)gbpC-Decreased mound size, aberrant fruiting body morphology, decreased chemotaxisGbpC and Pats1 play a role in chemotaxis. Pats1 null mutants show defects in cytokinesis

What post-translational modifications occur in D. discoideum membrane proteins, and how might they apply to selenoprotein msp?

Post-translational modifications of membrane proteins in D. discoideum have been extensively studied. Analysis of 127 major polypeptides from purified plasma membranes using two-dimensional gel electrophoresis revealed insights into modifications during cellular processes like receptor capping .

What expression optimization strategies can improve yields of functional recombinant D. discoideum Membrane selenoprotein?

To optimize expression of functional recombinant D. discoideum Membrane selenoprotein, researchers can consider several strategies:

  • Selenocysteine incorporation optimization: Since msp contains selenocysteine residues (denoted as 'U' in the sequence), ensuring efficient selenocysteine incorporation is crucial. This may involve co-expression of selenocysteine incorporation machinery components or optimization of culture media with selenium supplementation.

  • D. discoideum as expression host: Using D. discoideum itself as an expression host may yield properly folded and processed protein. D. discoideum has been shown to efficiently secrete recombinant proteins with yields of up to 20 mg/L for native proteins and 1 mg/L for heterologous proteins like GST .

  • Signal peptide optimization: The correct processing of secretion signal peptides has been demonstrated in D. discoideum . Optimizing the signal peptide for msp expression could enhance secretion and simplify purification.

  • Stable expression systems: Expression of recombinant proteins in D. discoideum has been shown to be stable for at least one hundred generations without selection pressure . Establishing a stable cell line expressing msp could provide a consistent source of the protein.

What analytical techniques are most effective for characterizing D. discoideum Membrane selenoprotein structure and function?

For comprehensive characterization of D. discoideum Membrane selenoprotein structure and function, a combination of analytical techniques is recommended:

  • Structural characterization:

    • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

    • Mass spectrometry for accurate mass determination and identification of post-translational modifications

  • Functional characterization:

    • Selenium-specific assays to assess selenocysteine incorporation and redox activity

    • Membrane localization studies using fluorescent tags or immunofluorescence

    • Interaction studies using pull-down assays, co-immunoprecipitation, or surface plasmon resonance

  • Cellular studies:

    • Gene knockout or knockdown studies to assess phenotypic effects

    • Complementation studies with mutant variants to identify critical residues

    • Localization studies to determine subcellular distribution

Two-dimensional gel electrophoresis coupled with microcomputer-based videodensitometry has proven effective for analyzing D. discoideum membrane proteins, allowing for detailed examination of protein changes during cellular processes .

How can site-directed mutagenesis be employed to study the functional domains of D. discoideum Membrane selenoprotein?

Site-directed mutagenesis represents a powerful approach for investigating the structure-function relationships of D. discoideum Membrane selenoprotein. Key strategies include:

  • Selenocysteine replacement: Substituting selenocysteine residues (at positions 32 and 84) with cysteine or other amino acids to assess the importance of selenocysteine for protein function and activity.

  • Transmembrane domain analysis: The protein sequence suggests the presence of transmembrane domains (approximately residues 64-121). Targeted mutations in these regions can help elucidate their role in membrane integration and protein function.

  • Conserved motif investigation: Identifying and mutating conserved motifs shared with other selenoproteins to determine their functional significance.

  • Signal peptide modifications: Alterations to the N-terminal region can help define the minimal signal sequence required for proper membrane targeting.

For expression of mutant variants, both E. coli and D. discoideum expression systems can be utilized . The resulting mutant proteins should be assessed for proper folding, selenocysteine incorporation, membrane localization, and functional activity to determine the impact of specific mutations.

How does D. discoideum Membrane selenoprotein compare structurally and functionally to selenoproteins in other organisms?

While the search results don't provide direct comparative information about D. discoideum Membrane selenoprotein relative to selenoproteins in other organisms, we can make some general observations based on selenoprotein biology.

Selenoproteins typically contain selenocysteine (Sec, U) incorporated at UGA codons that would normally signal translation termination. This incorporation requires specialized machinery, including a selenocysteine insertion sequence (SECIS) element in the mRNA and dedicated translation factors. The preservation of this complex machinery across diverse species suggests important functional roles for selenoproteins.

Many characterized selenoproteins have redox functions, with selenocysteine providing greater reactivity compared to cysteine due to its lower pKa. The presence of selenocysteine residues at positions 32 and 84 in D. discoideum Membrane selenoprotein suggests it may have similar redox functions.

The membrane localization of D. discoideum msp distinguishes it from many other selenoproteins, which are often found in the cytosol or other cellular compartments. This localization may indicate unique functions related to membrane integrity, signaling, or transport.

What insights can D. discoideum developmental studies provide about Membrane selenoprotein function?

D. discoideum offers a unique developmental system that transitions from single-cell amoebae to multicellular structures, providing opportunities to study protein function in different cellular contexts. While the search results don't specifically address the role of Membrane selenoprotein in D. discoideum development, we can draw parallels from studies of other membrane proteins in this organism.

The developmental cycle of D. discoideum involves aggregation, mound formation, and ultimately the formation of fruiting bodies. This process requires coordinated cell movement, adhesion, and signaling, all of which involve membrane proteins. Studies of presenilin proteins in D. discoideum have shown that they control development, and this function is conserved in human homologues .

Investigation of Membrane selenoprotein expression and localization throughout the developmental cycle could provide insights into its potential roles in:

  • Cell-cell adhesion during aggregation

  • Signaling during pattern formation

  • Cell differentiation during fruiting body formation

  • Stress responses during development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.