Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein A (grlA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference point.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
grlA; DDB_G0271684; Metabotropic glutamate receptor-like protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-798
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
grlA
Target Protein Sequence
LKQCKISVLLSGDWSDMGYNYQMNNARIKAESALNLEMSLCYKNLEVSIDLAKQAIEDSI KKGANFIVISSSVHTSIGYEYARLHRDKDIYWLIRGRGRPVPDDLPKVAVINFNTHLLHY TLGLVSGYLTTSGTVGFISPGPQILALANSNSFYLGALASRKNVTFLNAYTGSWYNPEVA YKASQMLISNGADFIGMSQDDMSVQKALMDSGKMALGITGFSNRLIWGSDIALSYITDWS DVFIKYAGHILNDTWPEYTDYYTTLAEGGSLLFDTFSYRVPSEVQKLVSLEIEKLKNSSY QPFRCNPMYSQINLNFDSNGCANDMEFKNTKLLLKGTDISKTINLGLYTIPIEFVDYSNS MKLGLTIVSGFCILFCIISMVLVIMFRHAKIIKSASPIFCLLILFGCIIIFSGCIIFSLS PTDGICGARVWLLSIGYTIFLGSLLVKNWRIWLLFDNPKLKKRSITNWKLYPFVAGILAA DVLILALWQGLGDIRSESRIGIDSLTKYQYANVCSSNDQGSVALYILLVFHGIKLLAACF ISFKIKAVDIEEFNESKPIASSIYIITFCLFIVIPLMVSPQSVASQVITIVVCAIVTTLI SISLLFGSKFYMMATQGLALNQTFATNTKSSSFSLSLEKQKSKSNGLEFEDSDESEEKLP QIKNYSNSEIPNLQHNHSRLAHFSSDSCTSAEQDSKLDLENQNDENEIENNQNNQNNIVE DCQKVEKLEKDENLEKDENLEKDENLEKDNENQSIIQKKRLSKNFNQSEIDPDDV
Uniprot No.

Target Background

Function
Metabotropic glutamate receptor-like protein A (grlA) may play a significant role in terminal differentiation.
Gene References Into Functions
  1. grlA plays essential roles in the post-aggregation stages of Dictyostelium development. PMID: 17950724
Database Links
Protein Families
BMP lipoprotein family; G-protein coupled receptor 3 family, GABA-B receptor subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, cell cortex. Cytoplasm, perinuclear region.

Q&A

What is the molecular structure and localization of GrlA in Dictyostelium discoideum?

GrlA is a 90-kDa seven-transmembrane G-protein-coupled receptor primarily localized to the plasma membrane and endoplasmic reticulum membranes in D. discoideum . The protein features a large extracellular domain with significant homology to bacterial periplasmic proteins . This structural characteristic suggests evolutionary conservation of sensing mechanisms between prokaryotes and eukaryotes. When studying GrlA localization, fluorescent protein tagging (e.g., GFP fusion constructs) enables visualization of its subcellular distribution without compromising receptor functionality .

What is the developmental expression pattern of GrlA?

The GrlA message is present throughout the developmental cycle of D. discoideum but shows notably increased expression levels during the post-aggregation stages . This developmental regulation suggests GrlA plays particularly important roles in the later stages of Dictyostelium development. When conducting developmental studies, researchers should consider performing quantitative RT-PCR at multiple timepoints (0h, 4h, 8h, 12h, 16h, 20h) after starvation induction to accurately capture the expression dynamics.

How does GrlA compare to other G-protein coupled receptors in Dictyostelium?

Dictyostelium possesses 55 genes encoding seven-transmembrane G-protein-coupled receptors distributed across five of the six known GPCR families . GrlA belongs to family 3 GPCRs, which includes 17 members in Dictyostelium that resemble GABA(B) receptors from higher eukaryotes . In contrast to GrlA, another family member, GrlH, has been identified as a receptor for AprA, an autocrine proliferation repressor that inhibits cell proliferation and acts as a chemorepellent . Similarly, another metabotropic receptor, DdmGluPR, shows phylogenetic evidence of having diverged after the mGluR family-GABA(B) receptor split but before mGluR family divergence .

What are the most effective methods for generating GrlA knockout mutants?

The creation of GrlA knockout mutants can be accomplished through several approaches:

  • Gene Replacement Vector Method: Design vectors containing a selectable marker (typically Blasticidin S resistance) flanked by 5′ and 3′ sequences specific to the grlA gene .

  • Cre-loxP System: For multiple gene mutations, the Cre-loxP system allows recycling of selectable markers. The system employs floxed-Bsr cassettes that can be removed through transient expression of NLS-cre, enabling sequential gene disruptions with the same marker .

When screening transformants, use PCR with primers that anneal outside the homologous recombination region to confirm successful integration. Southern blot analysis provides additional verification to exclude random integration events .

How can researchers effectively study GrlA signaling pathways?

To investigate GrlA signaling pathways, researchers should employ a multi-faceted approach:

  • Transcriptional Profiling: Compare wild-type and grlA-deficient strains to identify downstream genes affected by GrlA signaling. Previous studies revealed downregulation of genes involved in extracellular matrix organization and sporulation in grlA mutants .

  • Protein Interaction Studies: Yeast two-hybrid systems can identify proteins that interact with GrlA's intracellular domains .

  • Second Messenger Analysis: Measure changes in cAMP, calcium, or IP3 levels following receptor activation to identify the specific G-protein coupling and downstream effectors.

  • Developmental Phenotype Analysis: Monitor developmental progression with time-lapse imaging at 2-hour intervals to identify specific developmental stages affected by GrlA disruption.

What are the molecular mechanisms underlying GrlA's role in post-aggregation development?

GrlA deficient strains exhibit a significant delay in development specifically at the post-aggregation stage . This developmental role appears to be mediated through several interconnected mechanisms:

  • DIF-1 Response Modulation: GrlA deficient strains show an altered response to Differentiation Inducing Factor-1 (DIF-1), specifically affecting the expression of prestalk-specific genes ecmA and ecmB .

  • cAMP Signaling Regulation: The mutants display reduced car2 (cAMP receptor 2) and pkaC (protein kinase A catalytic subunit) transcript levels, indicating GrlA's involvement in regulating key components of the cAMP signaling pathway essential for proper development .

  • Extracellular Matrix Organization: Transcriptional profiling revealed that genes involved in biogenesis and organization of the extracellular matrix are significantly downregulated in GrlA deficient strains .

To further investigate these mechanisms, researchers should consider performing phosphoproteomics analysis comparing wild-type and grlA-null cells at different developmental timepoints to identify differential activation of signaling pathways.

How does GrlA contribute to sporulation efficiency in Dictyostelium?

GrlA deficient strains form a reduced number of spores compared to wild-type, although the germination efficiency of the formed spores remains comparable . The mechanism appears to involve:

  • Transcriptional Regulation: A large number of genes involved in the sporulation process are significantly downregulated in the GrlA mutant, as revealed by transcriptional profiling .

  • Extracellular Matrix Components: The biogenesis and organization of the extracellular matrix, critical for proper spore formation, are compromised in GrlA deficient strains .

To quantify this effect, researchers should perform sporulation efficiency assays comparing spore yields between wild-type and mutant strains under standardized conditions. Additionally, transmission electron microscopy can reveal ultrastructural defects in spore coat assembly in the mutant strains.

What insights does GrlA provide about the evolution of metabotropic receptors?

GrlA's structural and functional characteristics provide valuable insights into receptor evolution:

  • Conserved Domains: The large extracellular domain of GrlA shows homology to bacterial periplasmic proteins, suggesting an ancient evolutionary origin .

  • Family Relationships: Phylogenetic analysis positions GrlA among the 17 GABA(B)-like receptors in Dictyostelium .

  • Functional Conservation: Despite the evolutionary distance, GrlA's role in development demonstrates functional conservation of metabotropic signaling across eukaryotes.

This evolutionary conservation makes GrlA an excellent model for studying the fundamental principles of metabotropic receptor signaling that may apply across species.

How do the functions of GrlA compare with similar receptors in higher organisms?

Despite the evolutionary distance, GrlA shares several functional similarities with metabotropic receptors in higher organisms:

  • Developmental Regulation: Like metabotropic glutamate receptors in vertebrates that regulate neuronal development, GrlA regulates specific developmental processes in Dictyostelium .

  • Membrane Localization: Similar to mammalian GABA(B) receptors, GrlA localizes to the plasma membrane, where it can sense extracellular signals .

  • G-protein Coupling: Both GrlA and mammalian metabotropic receptors signal through G-protein coupled pathways, suggesting conservation of downstream signaling mechanisms .

What are common challenges in expressing recombinant GrlA and how can they be overcome?

Expressing recombinant GrlA presents several technical challenges:

  • Protein Size: At 90-kDa, GrlA is a large membrane protein that may encounter folding difficulties.

  • Membrane Integration: As a seven-transmembrane protein, proper integration into membranes is essential for function.

Recommended solutions include:

  • Using Dictyostelium expression systems rather than heterologous systems to ensure proper post-translational modifications.

  • Employing GFP fusion constructs to monitor expression and localization .

  • For purification purposes, consider adding a cleavable signal sequence and purification tag.

  • When expressing in heterologous systems, codon optimization for the host organism may improve expression levels.

What methods are most effective for studying GrlA-ligand interactions?

Despite extensive research, the natural ligand for GrlA remains unidentified. To investigate potential ligand interactions:

  • Binding Assays: Develop radioligand binding assays using purified receptor domains.

  • Receptor Activation Studies: Monitor changes in downstream signaling (cAMP, calcium flux) in response to candidate ligands.

  • Structure-Function Analysis: Create chimeric receptors combining domains from GrlA with better-characterized receptors to identify ligand-binding regions.

  • Computational Approaches: Use homology modeling and molecular docking to predict potential ligand binding sites and interactions.

Given GrlA's homology to bacterial periplasmic proteins and GABA(B) receptors, amino acids, peptides, or small metabolites should be considered as candidate ligands.

What emerging technologies could advance our understanding of GrlA function?

Several cutting-edge approaches hold promise for GrlA research:

  • CRISPR-Cas9 Genome Editing: While traditional knockout approaches have been successful, CRISPR-based methods could enable more precise modifications, including point mutations to specific domains.

  • Cryo-EM Structure Determination: Resolving the three-dimensional structure of GrlA would provide invaluable insights into its function and ligand binding.

  • Optogenetic Approaches: Developing light-responsive variants of GrlA could allow temporal control of receptor activation.

  • Single-Cell Transcriptomics: Analyzing transcriptional responses to GrlA activation at the single-cell level could reveal cell type-specific roles during development.

What are the most promising applications of GrlA research beyond basic science?

GrlA research has potential applications in several areas:

  • Drug Discovery Templates: As a member of the metabotropic receptor family, structural insights from GrlA could inform drug design for human metabotropic receptors.

  • Synthetic Biology: GrlA could be engineered as a component of synthetic signaling pathways in cell-based biosensors.

  • Developmental Biology Models: The role of GrlA in Dictyostelium development makes it a valuable model for studying conserved principles of multicellular development.

  • Evolutionary Biology: Comparative studies of GrlA and related receptors across species can illuminate receptor evolution and adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.