Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein C (grlC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, please specify them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
grlC; DDB_G0282461; Metabotropic glutamate receptor-like protein C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-800
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
grlC
Target Protein Sequence
DKEFKMLTLLTAQVDDLGFNNMINQGRIEVAKGMNIEDSRLLVVEGFNETFKHLLPIVQN DDIDLVICSSSGHLQACRAIAEMYINSTTIKTQFLVRGSSSPTRNLIYISYNYASANYIS GYFAALFSKTGKIGFVSPGQAANNNDSFVYAFWVGARQVNPDIKFYYYNIGNYLDVDKTV AATNDLLDMGCDVVGNTLDDFSTGDASIARGFPAIGTNGFPQRHVYGENVIYSYSYNWTK FFLPIAESVKSGNTNNSQWYADFDFDENKNFYHLDYGFEVNQSILDKMNTEIDYLKSTDR MSHPYYCNELIPQYAKENNLKLANVTGITLPIGCVTHQTFLSINKPFPGMTYLGNYKIKL VEVEFSQSLQYGFSITTGVLIAITIIMMLGIVRYKSTPSIRSASPIFLNFILAGGIIVYI GIIVWVGPANDHQCNARLWLVTLGFSTLIGSLVVKNFRIWLIFDNPELKSISITNYQLFP WVGACLVINIILMSILTSVGDLREIDAQGIDSLGKYEFMKVCKMNSSGASTLYTILAYFA ALLLVGVFVSWKIRIVDIQEFNESKAIANTLYAISFCLFVIVPLMISPQDKQSETIVLCT AGLFITTAALLIIFTPKFWRVFTLGDGGTNDMFRKKQSNVATARAESSKSSSGPKLNRRG NLVSDDFTDTETSISEKKVNVVAGAVLAEFTDDTISEFDDNNIEQDNDNDNDNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTNTSQPNDEKVEEKQQNDTEEEDKNQ
Uniprot No.

Target Background

Database Links
Protein Families
BMP lipoprotein family; G-protein coupled receptor 3 family, GABA-B receptor subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Recombinant Dictyostelium discoideum grlC protein?

Recombinant Full Length Dictyostelium discoideum Metabotropic glutamate receptor-like protein C (grlC) is a protein that spans amino acids 22-800 of the mature protein. When expressed recombinantly, it is typically fused to an N-terminal His tag and expressed in E. coli expression systems. The full amino acid sequence includes multiple functional domains characteristic of metabotropic glutamate receptors, including transmembrane regions . The protein in its recombinant form is commonly available as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis .

How does grlC relate to other metabotropic glutamate receptors?

Metabotropic glutamate receptors (mGluRs) are a class of G-protein-coupled receptors characterized by seven transmembrane regions that modulate excitatory synaptic transmission in the nervous system of higher organisms. Phylogenetic analysis suggests that Dictyostelium grlC-type receptors diverged after the mGluR family-GABA(B) receptors split but before mGluR family divergence .

Similar to Drosophila DmXR, the residues of mGluRs involved in binding the alpha-carboxylic and alpha-amino groups of glutamate are well conserved in Dictyostelium receptors like grlC, but the residues that interact with the gamma-carboxylic group of glutamate are not conserved . This suggests a different ligand specificity or binding mechanism compared to mammalian mGluRs.

How do knockout mutations in grlC affect Dictyostelium cellular behavior?

While specific data for grlC is limited in the provided search results, studies on related receptors like DdmGluPR show that null mutations result in significant phenotypic alterations. These include:

  • Accelerated growth at high cell density, with cultures reaching higher final densities than wild-type cells

  • Delayed aggregate formation upon starvation

  • Impaired chemotaxis toward cAMP

  • Altered expression patterns of cAMP signaling components

Similar experiments with grlC knockout mutants would be valuable for comparative analysis with other metabotropic glutamate receptor-like proteins in Dictyostelium.

What are the potential signaling pathways downstream of grlC in Dictyostelium?

Based on studies of related receptors in the metabotropic glutamate receptor family, signaling likely involves G-protein-coupled pathways. Evidence from studies of grlD suggests that there are both G-protein-dependent and G-protein-independent pathways downstream of these receptors . Experimental approaches to elucidate grlC signaling pathways should include:

  • Analysis of calcium flux and cAMP production in response to receptor activation

  • Phosphorylation studies of potential downstream targets

  • Genetic interaction studies using double mutants with components of known signaling pathways

  • Proteomic analysis of protein interactions in wild-type versus grlC-null cells

How does grlC function compare to mammalian metabotropic glutamate receptors?

While mammalian metabotropic glutamate receptors function in neuronal signaling, Dictyostelium lacks a nervous system, suggesting alternative roles for these receptor-like proteins. The conservation of specific binding residues but not others indicates a divergence in ligand specificity .

Potential functions for grlC in Dictyostelium may include:

  • Intercellular communication during development

  • Sensing of environmental cues during growth and aggregation

  • Regulation of growth and cell density

  • Modulation of chemotactic responses

Comparative functional studies between mammalian mGluRs and Dictyostelium grlC would provide evolutionary insights into this receptor family.

What are the optimal storage and handling conditions for recombinant grlC protein?

For optimal stability and activity of recombinant grlC protein:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • Brief centrifugation is recommended prior to opening to bring contents to the bottom of the vial

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% and aliquot for long-term storage

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Working aliquots may be stored at 4°C for up to one week

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during storage .

How can researchers effectively design experiments to study grlC function in Dictyostelium?

When designing experiments to investigate grlC function, consider the following methodological approaches:

  • Genetic manipulation approaches:

    • CRISPR-Cas9 gene editing for precise mutations

    • Overexpression studies using inducible promoters

    • Rescue experiments in knockout backgrounds

  • Developmental assays:

    • Time-course analysis of development on non-nutrient agar

    • Quantification of aggregation efficiency

    • Assessment of chemotactic responses using micropipette assays

  • Biochemical approaches:

    • Ligand binding assays to identify potential natural ligands

    • Co-immunoprecipitation to identify interacting proteins

    • Phosphorylation studies to assess downstream signaling events

  • Localization studies:

    • Fluorescent protein fusions for live-cell imaging

    • Immunofluorescence with specific antibodies

    • Fractionation studies to assess membrane association

  • Single-cell analysis:

    • Microfluidic devices for controlled stimulus delivery

    • Live imaging of signaling using FRET-based sensors

    • Quantification of cell motility parameters

What technical challenges should researchers anticipate when working with recombinant grlC?

Researchers working with recombinant grlC should be prepared for several technical challenges:

  • Protein solubility issues:

    • As a membrane protein, grlC may have limited solubility

    • Consider using appropriate detergents for solubilization

    • Test different buffer conditions to optimize stability

  • Expression and purification considerations:

    • E. coli expression systems may yield inclusion bodies

    • Codon optimization may be necessary for efficient expression

    • Multiple purification steps may be required to achieve high purity

  • Functional assays:

    • Lack of known natural ligands complicates functional studies

    • Receptor activation may require specific conditions or co-factors

    • Activity assays may need to be developed or adapted from mammalian systems

How should researchers interpret growth phenotypes in grlC mutant strains?

When analyzing growth phenotypes in grlC mutant strains, consider:

  • Growth curve analysis:

    • Compare doubling times during exponential phase

    • Assess final cell densities at stationary phase

    • Determine lag phase duration under different conditions

  • Environmental influences:

    • Test growth in different media compositions

    • Assess responses to varying osmotic conditions

    • Examine growth at different temperatures

  • Cell density effects:

    • Examine colony morphology on solid media

    • Assess growth at different starting cell densities

    • Measure secreted factors that might influence growth

Based on studies of related receptors, loss of grlC function might result in faster growth at high cell density and higher final cell densities compared to wild-type cells . This suggests a potential role in density sensing or growth inhibition at high cell densities.

What approaches can resolve contradictory data when studying grlC signaling pathways?

When faced with contradictory data regarding grlC signaling:

  • Verify genetic backgrounds:

    • Confirm knockout status through PCR and sequencing

    • Check for potential second-site mutations

    • Consider creating new mutants using different techniques

  • Validate experimental conditions:

    • Standardize growth and development conditions

    • Control for cell density effects

    • Ensure consistent buffer compositions and pH

  • Apply multiple methodologies:

    • Combine genetic, biochemical, and cell biological approaches

    • Use both population-level and single-cell assays

    • Implement both gain-of-function and loss-of-function strategies

  • Examine genetic interactions:

    • Create double mutants with known signaling components

    • Test epistatic relationships to place grlC in signaling hierarchies

    • Consider redundancy with other grl family members

Studies of related receptors suggest complex signaling networks with both G-protein-dependent and independent pathways . This complexity may explain seemingly contradictory results in different experimental contexts.

What comparative analyses would provide insights into the evolutionary significance of grlC?

To understand the evolutionary significance of grlC:

  • Phylogenetic analysis:

    • Compare sequences across evolutionary diverse organisms

    • Identify conserved domains and motifs

    • Determine rates of evolutionary change in different protein regions

  • Functional complementation:

    • Test if grlC can rescue phenotypes in mGluR mutants in other systems

    • Express mammalian mGluRs in Dictyostelium grlC mutants

    • Assess conservation of downstream signaling pathways

  • Structural comparisons:

    • Model the 3D structure of grlC based on known mGluR structures

    • Identify conserved and divergent binding pockets

    • Predict ligand specificity based on structural features

  • Expression pattern analysis:

    • Compare tissue/cell-specific expression in different organisms

    • Analyze developmental regulation across species

    • Identify conserved regulatory elements in promoter regions

The evolutionary position of Dictyostelium grlC receptors—diverging after the mGluR family-GABA(B) receptors split but before mGluR family divergence—makes them valuable for understanding the ancestral functions and subsequent specialization of this important receptor family .

What are promising approaches for identifying natural ligands for grlC?

Identifying natural ligands for grlC remains a significant challenge. Promising approaches include:

  • Untargeted metabolomics:

    • Compare conditioned media from wild-type and grlC mutant cultures

    • Analyze metabolites that accumulate differentially

    • Test candidate molecules in functional assays

  • Binding assays with candidate ligands:

    • Screen glutamate analogs and derivatives

    • Test other amino acids and small peptides

    • Examine secreted factors from Dictyostelium cultures

  • In silico docking studies:

    • Model the ligand-binding domain structure

    • Perform virtual screening of metabolite libraries

    • Validate top hits through biochemical assays

  • Expression cloning approaches:

    • Develop reporter systems linked to grlC activation

    • Screen fractionated extracts for activating components

    • Identify active fractions through iterative purification

How might genomic and proteomic approaches advance understanding of grlC function?

Advanced genomic and proteomic approaches can provide new insights into grlC function:

  • RNA-Seq analysis:

    • Compare transcriptomes of wild-type and grlC mutant cells

    • Perform time-course analysis during development

    • Identify genes co-regulated with grlC

  • ChIP-Seq studies:

    • Identify transcription factors regulating grlC expression

    • Map changes in chromatin structure at the grlC locus during development

    • Analyze epigenetic modifications associated with grlC regulation

  • Phosphoproteomics:

    • Compare phosphorylation patterns in wild-type and mutant cells

    • Identify signaling pathways altered by grlC mutation

    • Track temporal changes in phosphorylation following receptor activation

  • Interactome analysis:

    • Perform BioID or proximity labeling to identify interacting proteins

    • Use quantitative proteomics to compare protein complexes

    • Validate key interactions through co-immunoprecipitation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.