Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein D (grlD)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

GrlD is encoded by the grlD gene (UniProt ID: Q54L53) and belongs to the GPCR family 3. Recombinant GrlD is produced via heterologous expression systems, including E. coli, yeast, and mammalian cells, often fused with a His tag for purification . Key features include:

PropertyDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells
TagN-terminal His tag
Protein Length769 amino acids (residues 23–791)
Purity≥85–90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

The full-length mature protein contains extracellular ligand-binding domains, transmembrane regions, and intracellular signaling motifs .

Functional Roles in Dictyostelium discoideum

GrlD mediates polyphosphate-dependent signaling pathways critical for cellular adaptation:

Polyphosphate Binding and Signaling

  • GrlD acts as the primary receptor for extracellular polyP, with binding confirmed via biotinylated polyP assays .

  • Cells lacking GrlD (grlD¯) fail to bind polyP or respond to polyP-induced proteasome inhibition, proliferation arrest, and aggregation .

Nutrient-Dependent Responses

  • In low-nutrient conditions, GrlD activates RasC and Akt pathways to inhibit proteasomes and proliferation, priming cells for developmental aggregation .

  • During starvation, GrlD regulates extracellular polyP accumulation alongside polyphosphate kinase 1 (Ppk1) and inositol hexakisphosphate kinase A (I6kA) .

ProcessGrlD-Dependent MechanismPhenotype in grlD¯ Cells
Proteasome inhibitionRasC/Akt pathway activation No response to polyP
Proliferation arrestNutrient-sensitive signaling Unaffected in high nutrients
Aggregation inductionPolyP priming via developmental gene expression (e.g., csA) Delayed or absent aggregation

Applications in Research

Recombinant GrlD is used to study:

  • GPCR Signaling Mechanisms: Elucidating polyP sensing and downstream pathways in eukaryotes .

  • Developmental Biology: Investigating starvation-induced aggregation and sporulation in D. discoideum .

  • Disease Models: PolyP signaling is conserved in humans; GrlD studies inform cancer and platelet dysfunction research .

Key Research Findings

  • Binding Specificity: GrlD knockout cells show no polyP binding, rescued by grlD overexpression .

  • Dual Nutrient Signaling: GrlD mediates polyP effects only in low-nutrient conditions, highlighting context-dependent signaling .

  • Evolutionary Conservation: GrlD’s role in polyP sensing parallels mechanisms in yeast and mammals .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
grlD; DDB_G0286895; Metabotropic glutamate receptor-like protein D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-791
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
grlD
Target Protein Sequence
EPEKKFKLITLLAAHVQDLGFNNMVNRGHVEVSKAMKLEDSQAIVVVGYNDTIRILAPLV AVGDVDLVICSSQDHAQACRELATKYKGSSIKTQFLVRGSGEATSNLITYSYNYANANYI SGYFAGLYTKTNKIGFLSPGAIDNNNDSFVYAFWYGAKRANPDISFYYYNIGNYLNPDKT VAATKDLLDMGCDMVADTLNDFSTGNTLIANNRKTAMGTSGFPQRDVYGEDVIYSYNYNW FKLFYPVAQSVYSGNTNNTNWYADFNLNETISFFGLSFSFTVPNETLTKFYEELDYLKRT PRLSHPYFCNDLMYEYAKKNHLTMSTNDSTHCLANSQFTRINAPFPGMTWLGNYEITLTE VYQSRPIQIAISSISSFFIVTVLVMMGLVVRFRKNPSIRSASPIFLNFILFGALIIYVGI IIWSSSINSASCNAQFWLVTLGFTTLIGSLVVKNVRIWLIFDNPELKLVKITNLQLVPWV GVCLVINIILMSILTSVGDLREVNAQGIDSLGKYEFMRICKMNSSGASTLYTILAYFAAL LLIGVFVSWKIRIVDILEFNESKAIANTLYAISFCLFVIVPLMISPQDKQSEKIILCIAG LFIVTAAVLIIFVPKFYRVYIFGSGGTSDMFYKKKKQSPVATARAESTSKGSSGGGAGSG GATGGSGVKTNKRGNLVSGDFSDDTESSLSEPNKPVKVVAGAVLAEFTDDTISDLDNIDQ PIEIITENGQDSNNNNNNEENKDNNIENNKISEEIKENLKNEENNDGDN
Uniprot No.

Target Background

Database Links
Protein Families
BMP lipoprotein family; G-protein coupled receptor 3 family, GABA-B receptor subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is GrlD and how is it classified structurally?

GrlD is one of 17 putative metabotropic glutamate receptor-like proteins (Grl proteins) encoded in the Dictyostelium discoideum genome. It belongs to the G protein-coupled receptor (GPCR) superfamily . Phylogenetic analysis of related proteins suggests that the metabotropic glutamate receptor family diverged after the mGluR family-GABA(B) receptors split but before mGluR family divergence .

Unlike some metabotropic glutamate receptors that bind glutamate, GrlD appears specialized for binding polyphosphate molecules (chains of five or more orthophosphates linked by high-energy phosphoanhydride bonds) . The protein likely contains the characteristic seven-transmembrane domain structure typical of GPCRs and is localized to the plasma membrane .

What is the primary function of GrlD in Dictyostelium discoideum?

GrlD functions as a cell surface receptor that mediates the binding and cellular response to extracellular polyphosphate . Research has demonstrated that GrlD is essential for:

  • Mediating polyphosphate-induced proteasome inhibition

  • Regulating cell proliferation in response to polyphosphate (particularly in low-nutrient conditions)

  • Facilitating polyphosphate-induced aggregation during starvation

  • Modulating cell-substratum adhesion and cytoskeletal F-actin levels in response to nutrient availability

  • Contributing to the transition from vegetative growth to the developmental phase

These functions collectively suggest that GrlD plays a crucial role in cellular responses to environmental conditions, particularly during nutrient limitation.

How can recombinant GrlD be expressed and purified for research purposes?

Based on the experimental approaches described in the literature, recombinant GrlD can be generated through the following methodology:

  • Gene Synthesis and Cloning:

    • The grlD cDNA sequence can be synthesized based on the sequence provided in Dictybase.org

    • The synthetic gene should be inserted into an appropriate expression vector (such as pDXA-3C) using restriction enzymes like HindIII and XhoI

  • Transformation and Selection:

    • Transform the expression construct into Dictyostelium cells

    • Select stable transformants using G418 (10 μg/ml) until stable colonies are isolated

    • Verify expression by assessing grlD transcript levels using specific primers (e.g., 5′-CGCGAAGCTTATGAAAATTAATTCATT-3′ and 5′-CTAATTTCAATTCTGGATTATC-3′)

  • Cell Culture for Protein Production:

    • For cells that struggle in shaking culture, grow them on SM agar plates with bacteria

    • After 3-4 days of growth, wash cells off plates and remove residual bacteria

    • Culture at 5 × 10^5 cells/ml in HL5 containing G418 for 48 hours before use in experiments

Alternatively, for studying the protein's localization, GrlD can be expressed as a green fluorescent protein fusion protein, which has been shown to localize to the plasma membrane of axenically grown Ax-2 cells .

What methods are most effective for assessing GrlD function in Dictyostelium?

Several complementary approaches have proven effective for investigating GrlD function:

  • Gene Knockout Studies:

    • Generate grlD^- cells through homologous recombination

    • Compare phenotypes between wild-type, knockout, and rescued cells

  • Binding Assays:

    • Assess binding of polyphosphate to intact cells

    • Compare binding between wild-type and grlD^- cells to determine receptor specificity

  • Functional Assays:

    • Proliferation assays in various nutrient conditions

    • Proteasome activity measurements using fluorogenic peptide substrates

    • Aggregation assessments in response to polyphosphate

    • Cell-substratum adhesion assays

    • F-actin quantification using phalloidin staining

  • Rescue Experiments:

    • Express GrlD in grlD^- cells to create grlD^-/grlH^OE cells

    • Confirm expression levels using qRT-PCR

    • Determine if normal phenotypes are restored

  • Developmental Studies:

    • Monitor aggregation following starvation

    • Assess expression of developmental markers like CsaA, Car1, and AcaA

How does GrlD mediate polyphosphate signaling in Dictyostelium?

GrlD mediates polyphosphate signaling through a G protein-coupled mechanism that varies depending on nutrient conditions:

  • Signal Reception:

    • GrlD serves as the cell surface receptor that binds extracellular polyphosphate

    • Cells lacking GrlD show reduced polyphosphate binding

  • Downstream Signaling:

    • In low nutrient conditions, polyphosphate inhibits proliferation through a mechanism mediated by GrlD, RasC, and proteasome inhibition

    • In high nutrient conditions, polyphosphate inhibits proliferation through a different mechanism that is not dependent on GrlD or proteasome inhibition

  • Cellular Responses:

    • Polyphosphate binding to GrlD leads to:

      • Proteasome inhibition

      • Proliferation inhibition

      • Induction of aggregation

      • Changes in cell-substratum adhesion

      • Alterations in cytoskeletal F-actin levels

The signaling pathway appears to involve RasC, as cells lacking RasC were unresponsive to polyphosphate-induced proteasome inhibition under all nutrient conditions and to polyphosphate-induced proliferation inhibition under low nutrient conditions .

How does the GrlD signaling pathway differ under varying nutrient conditions?

Research has revealed distinct GrlD-mediated signaling mechanisms depending on nutrient availability:

Nutrient ConditionProliferation Inhibition MechanismProteasome InhibitionPathway Components
High NutrientGrlD-independentGrlD-dependentUnknown factors
Low NutrientGrlD-dependentGrlD-dependentGrlD, RasC, Proteasome

In contrast, under low nutrient conditions, polyphosphate inhibits proliferation through a pathway that requires GrlD, involves RasC, and leads to proteasome inhibition. This suggests that the nutrient context significantly alters how the GrlD-mediated polyphosphate signal is processed and the cellular outcomes it produces .

What role does GrlD play in Dictyostelium development and aggregation?

GrlD plays a critical role in the developmental transition and aggregation process in Dictyostelium:

The evidence collectively suggests that GrlD is essential for the proper execution of early developmental processes in Dictyostelium, particularly in the transition from unicellular growth to multicellular aggregation.

How does polyphosphate-GrlD signaling interact with other developmental signaling pathways?

The interaction between polyphosphate-GrlD signaling and other developmental pathways in Dictyostelium involves several components:

  • cAMP Signaling Pathway:

    • While polyphosphate through GrlD induces aggregation, the canonical developmental pathway in Dictyostelium involves cAMP signaling

    • Similar to GrlD, another glutamate receptor-like protein (DdmGluPR) affects the expression of cAMP signaling components

    • DdmGluPR-null cells show delayed and peaked expression of cAMP-signaling components (cAR1 and aca) at 8 hours after starvation, compared to wild-type cells where expression peaks at 2-4 hours

  • Chalone Signaling:

    • Dictyostelium uses chalones (AprA and CfaD) as secreted proteins that inhibit proliferation

    • Other G protein-coupled receptors like GrlH mediate responses to these chalones

    • GrlH is involved in AprA-induced proliferation inhibition and chemorepulsion

  • Nutrient Sensing Integration:

    • The polyphosphate-GrlD pathway appears to integrate with nutrient sensing mechanisms

    • Under high nutrient conditions, polyphosphate still causes proteasome inhibition through GrlD, potentially priming cells for eventual development while abundant nutrients prevent the actual transition

This suggests a complex interplay between different signaling systems that collectively regulate Dictyostelium's transition from growth to development, with GrlD playing a significant role in this regulatory network.

What structural features of GrlD enable polyphosphate binding rather than glutamate binding?

While the search results don't provide direct information about GrlD's binding domain structure, we can infer from related glutamate receptor-like proteins:

Understanding these structural adaptations would provide valuable insights into how a receptor family evolved from neurotransmitter binding to sensing an inorganic signaling molecule like polyphosphate.

What is the molecular mechanism by which GrlD activation leads to proteasome inhibition?

The precise molecular mechanism linking GrlD activation to proteasome inhibition remains to be fully elucidated, but current research suggests:

  • G Protein Signaling:

    • As a GPCR, GrlD likely activates heterotrimeric G proteins upon polyphosphate binding

    • This activation would trigger downstream signaling cascades

  • RasC Involvement:

    • RasC appears to be a critical component in the pathway, as cells lacking RasC were unresponsive to polyphosphate-induced proteasome inhibition

    • This suggests that RasC functions downstream of GrlD in the signaling pathway

  • Potential Mechanisms:

    • The pathway could involve:

      • Post-translational modifications of proteasome subunits

      • Regulation of proteasome assembly

      • Production of endogenous proteasome inhibitors

      • Alterations in subcellular localization of proteasomes

  • Research Approach:

    • To elucidate this mechanism, researchers could:

      • Identify proteins that interact with GrlD using co-immunoprecipitation or proximity labeling

      • Examine phosphorylation states of proteasome subunits after GrlD activation

      • Use genetic screens to identify additional components in the pathway

      • Employ pharmacological inhibitors of different signaling pathways to identify those required for GrlD-induced proteasome inhibition

Uncovering this mechanism would provide significant insights into how extracellular signals regulate proteasome activity, a fundamental process in cellular protein homeostasis.

How does GrlD function compare to other Dictyostelium G protein-coupled receptors?

Dictyostelium discoideum possesses a diverse array of G protein-coupled receptors with varied functions, offering interesting comparisons to GrlD:

  • Receptor Diversity:

    • The Dictyostelium genome encodes 61 putative GPCRs, including 17 GABA B or metabotropic glutamate receptor-like proteins (Grl proteins)

    • GrlD is just one member of this family with a specialized function

  • Comparative Functions:

    ReceptorLigandPrimary FunctionsReference
    GrlDPolyphosphateMediates proliferation inhibition, proteasome inhibition, aggregation
    GrlHAprAMediates chemorepulsion and proliferation inhibition
    DdmGluPRUnknownInvolved in early development; affects chemotaxis toward cAMP
    cAR1cAMPActs as chemoattractant receptor during development
  • Signaling Mechanisms:

    • While GrlD mediates sensing of polyphosphate, other receptors like GrlH mediate the sensing of protein-based chalones (AprA)

    • Both participate in mechanisms that regulate cell density and movement, but through different ligands and potentially different downstream pathways

  • Developmental Roles:

    • GrlD is critical for polyphosphate-induced aggregation

    • Other GPCRs like cAR1 are essential for cAMP-induced chemotaxis and aggregation

    • DdmGluPR-null cells show delayed aggregate formation and impaired chemotaxis toward cAMP

This diversity of receptors allows Dictyostelium to sense and respond to various environmental signals, with GrlD specialized for polyphosphate sensing in particular contexts.

How conserved is the polyphosphate signaling mechanism across eukaryotes?

The polyphosphate signaling system has varying degrees of conservation across eukaryotes:

  • Polyphosphate as a Signaling Molecule:

    • Polyphosphate is highly ubiquitous across species and acts as a signaling molecule in many eukaryotic cells

    • It elicits a number of responses in eukaryotic cells, but the mechanisms mediating these effects have been poorly understood

  • Receptor Mechanisms:

    • The identification of GrlD as a receptor for polyphosphate in Dictyostelium represents the first reported G protein-coupled receptor mediating polyphosphate sensing in eukaryotes

    • The research suggests that "a eukaryotic cell uses a G protein-coupled receptor to mediate the sensing and response to extracellular polyphosphate"

  • Conservation in Other Organisms:

    • While polyphosphate itself is found across eukaryotes, including humans, the specific receptors and signaling pathways appear to have evolved differently

    • In mammals, polyphosphate affects various processes including blood coagulation, inflammation, and bone formation, but the receptors involved are largely different from those in Dictyostelium

  • Evolutionary Implications:

    • The adaptation of a metabotropic glutamate receptor-like protein for polyphosphate sensing in Dictyostelium suggests evolutionary plasticity in GPCR ligand recognition

    • This finding raises questions about whether similar adaptations might have occurred in other eukaryotic lineages

The discovery of GrlD's role provides a valuable model system for understanding how polyphosphate signaling can be mediated in eukaryotes, potentially informing research in more complex organisms.

What are the most promising approaches for structural characterization of GrlD?

Several cutting-edge approaches could be employed for structural characterization of GrlD:

  • Cryo-Electron Microscopy (Cryo-EM):

    • This technique has revolutionized membrane protein structural biology

    • Could reveal the three-dimensional structure of GrlD, particularly in complex with polyphosphate

    • May uncover conformational changes associated with ligand binding and activation

  • X-ray Crystallography:

    • While challenging for GPCRs, advances in crystallization techniques (including lipidic cubic phase crystallization) could make this feasible

    • Would provide high-resolution structural information about the binding pocket

  • NMR Spectroscopy:

    • Solution or solid-state NMR could provide insights into the dynamics of GrlD

    • Particularly useful for studying conformational changes upon ligand binding

  • Molecular Dynamics Simulations:

    • Computational approaches based on homology models could predict polyphosphate binding modes

    • Can generate testable hypotheses about critical residues for binding and activation

  • Cross-linking Mass Spectrometry:

    • Could identify points of contact between GrlD and polyphosphate

    • Useful for validating computational models

Structural characterization would significantly advance our understanding of how this receptor specifically recognizes polyphosphate and initiates signaling.

How might GrlD signaling mechanisms inform therapeutic approaches in higher organisms?

Understanding GrlD signaling could have broader implications for therapeutic development:

  • Polyphosphate in Human Physiology and Pathology:

    • Polyphosphate plays roles in human blood coagulation, inflammation, bone mineralization, and neuronal function

    • Abnormal polyphosphate regulation has been implicated in thrombosis, cancer, and neurodegenerative diseases

  • Therapeutic Target Identification:

    • Elucidating the mechanisms by which GrlD regulates proteasome activity could reveal new approaches to modulate proteasome function

    • Proteasome inhibitors are already used in cancer treatment (e.g., bortezomib)

    • Novel approaches to proteasome regulation might emerge from understanding natural regulatory mechanisms

  • Drug Design Principles:

    • The polyphosphate binding pocket of GrlD could serve as a template for designing compounds that modulate polyphosphate signaling

    • Such compounds might have applications in managing thrombotic disorders or inflammatory conditions

  • Cellular Response to Environmental Stress:

    • GrlD's role in mediating responses to nutrient limitation might inform approaches to modulating cellular stress responses

    • This could be relevant for conditions involving cellular stress adaptation, such as ischemia or cancer

  • Developmental Signaling:

    • Insights into how GrlD coordinates developmental transitions could inform approaches to directing cell differentiation in regenerative medicine

While direct therapeutic applications remain speculative, fundamental insights from this model system could eventually contribute to novel therapeutic strategies for multiple conditions.

What are the challenges in producing functional recombinant GrlD for in vitro studies?

Producing functional recombinant GrlD presents several technical challenges:

  • Expression System Selection:

    • GPCRs are notoriously difficult to express in heterologous systems

    • Expression in Dictyostelium itself may be preferable to maintain proper folding and post-translational modifications

    • As noted in the research, even cells expressing GrlD were "unable to survive in shaking culture, but did proliferate in axenic media on plastic dishes"

  • Protein Solubilization and Stability:

    • As a membrane protein, GrlD requires careful selection of detergents or lipid nanodiscs for extraction and purification

    • Maintaining stability during purification is challenging for many GPCRs

  • Functional Verification:

    • Confirming that the recombinant protein retains polyphosphate binding capability is essential

    • This may require development of specialized binding assays

  • Structural Integrity:

    • Ensuring the protein maintains its native conformation during purification

    • Some GPCRs require stabilizing mutations or fusion partners to maintain structural integrity

  • Scale-Up Considerations:

    • Producing sufficient quantities for structural and functional studies can be difficult

    • The noted growth difficulties suggest that alternative growth methods might be needed for large-scale production

Researchers may need to employ specialized approaches such as fusion with stabilizing proteins, thermostabilizing mutations, or lipid nanodisc incorporation to overcome these challenges.

What are the optimal conditions for studying GrlD-polyphosphate interactions in vitro?

Based on the available research, the following conditions would likely be optimal for studying GrlD-polyphosphate interactions:

  • Buffer Composition:

    • Physiological buffers that mimic the extracellular environment of Dictyostelium

    • Careful consideration of divalent cation concentrations, as these can affect polyphosphate conformation and binding

  • Polyphosphate Preparation:

    • Well-defined polyphosphate chain lengths (the research suggests chains of five or more orthophosphates)

    • Consideration of polyphosphate concentration ranges that reflect physiological conditions (similar to those observed in stationary phase cells)

  • Membrane Environment:

    • Native-like membrane environment, possibly using lipid nanodiscs or reconstituted proteoliposomes

    • Composition reflecting the Dictyostelium plasma membrane

  • Detection Methods:

    • Fluorescently labeled polyphosphate for binding studies

    • Surface plasmon resonance for real-time binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Control Experiments:

    • Comparison with mutated GrlD variants

    • Competitive binding with other potential ligands

    • Positive controls using intact cells with verified polyphosphate binding

  • Downstream Signaling Assays:

    • GTPγS binding assays to measure G protein activation

    • Purified G protein components to reconstitute the initial signaling events

These conditions would provide a robust system for characterizing the molecular details of GrlD-polyphosphate interactions and the resulting signaling events.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.