Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein E (grlE)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant GrlE (UniProt ID: Q54ET0) is a full-length protein (28–816 amino acids) fused to an N-terminal His tag, expressed in Escherichia coli . Key specifications include:

ParameterDetails
Host SystemE. coli
TagHis tag
Purity≥90% (SDS-PAGE) or ≥85% (alternative sources)
StorageLyophilized powder at -20°C/-80°C; Tris/PBS buffer with 6% trehalose
Reconstitution0.1–1.0 mg/mL in deionized water; glycerol (5–50%) recommended for stability

This recombinant form retains functional epitopes for biochemical studies, enabling investigations into GPCR dynamics .

Role in G-Protein Signaling Pathways

GrlE is implicated in GPCR-mediated signal transduction, a process critical for chemotaxis and developmental transitions in Dictyostelium . Key findings include:

  • G-Protein Coupling: Like other Dictyostelium GPCRs, GrlE likely interacts with heterotrimeric G-proteins (e.g., Gα2βγ) to activate downstream effectors .

  • Membrane Dynamics: FRET and TIRFM studies show that GPCRs and G-proteins cycle between cytosolic and plasma membrane pools, with receptor activation altering dissociation kinetics .

  • Developmental Regulation: Extracellular polyP signaling via Grl proteins primes cells for aggregation under starvation, mediated by RasC and Akt pathways .

Applications in Research

Recombinant GrlE serves as a tool for:

4.1. Receptor-Ligand Interaction Studies

  • Binding Assays: Used to identify ligands via competitive displacement or fluorescence polarization .

  • Structural Biology: Supports crystallization trials or cryo-EM studies to resolve GPCR conformations .

4.2. Antibody Development

Recombinant GrlE facilitates the generation of monoclonal antibodies for:

  • Localization studies (e.g., immunofluorescence) .

  • Western blotting to quantify endogenous GrlE expression .

4.3. Drug Discovery

Serves as a target for screening small molecules modulating GPCR activity, with implications for neurodegenerative and metabolic diseases .

Technical Challenges and Solutions

ChallengeMitigation Strategy
Low Yield in E. coliCodon optimization or use of alternative hosts (e.g., baculovirus)
Protein AggregationAdditive screening (e.g., glycerol, trehalose) during reconstitution
Functional ValidationCross-validation with grlE knockout strains in chemotaxis assays

Future Directions

  1. Ligand Identification: High-throughput screening to characterize GrlE-specific agonists/antagonists .

  2. Crosstalk Analysis: Investigate interactions with other Grl family members (e.g., GrlD, GrlC) .

  3. Therapeutic Exploration: Leverage Dictyostelium models to study GrlE orthologs in human diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
grlE; GluPR; DDB_G0291356; Metabotropic glutamate receptor-like protein E; DdmGluPR; GABA-B receptor-like protein grlE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-816
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
grlE
Target Protein Sequence
EVVKPNPAKPDELVIAFMSPYFDPEYTQYSGAAEYALSKFNETFKTKYSKTIKLHTFTDT NDVIDSLDLVTMPVNGIVGPAYSGSSSTACLVFGAFAVPSISFYATGASLSNSGSYPYFQ RVMPDDRLQVQAILSLLKKNGWTRVSCIHTNEDYGNGGADQLVQQSNAQGITVNTNQAID PVDNGIAPEQLYYDIVFDNLEAAKSRVIVLYALFPPDCLEIWKQAKARGFLGEGFTWIVT DGCAELTGGTDPDLLGVLATFPSYGLGTEAYTDFERTIVNDYNNNTGDAFYKGASFSYDA TYAMLMGIEAVLAKGGDPWDGEQVRTELRNLKFNGITGTIAFDKNTGDRLYGEFALLNLI NSTKGSFDPIGKINPDSGEITLKSDILYSGPTYKVPSDYQVVVFDRTLNIVLGVITGVCV LIVIGIGSVIALQWRKFRYSSPLFCMFIIIGALMGLASVFTLLPTPTTPLCSGFPWLLGL GYVIVFGTLFTKTWRTWRLFSNARKFKIIRITNKFIITLVGGFVLLESIFMIIWTAVDRP IPLAEPIFKAGEAQLQCTSDSEAWWYVFVFYKVFYILFGVFLAFKTRNVVDSLNESKPIT LALYNLTFVMVVAIALGFILRDNPIAIIVIQTIAILLGFTVTVSVLFLPKVWMILSGQQH SMDSIGTSMDSMGRSNGNTTEAESTRGYTNKDYNNQSVGRSFSAHATGFKDVAPSNHPQL GIVYTGGDNFPRVGSSQTAASRSEAEINVSKDVLAKANKKNEEEFGEFFLKPSEDNILKK KKKKKNNNK
Uniprot No.

Target Background

Function
This protein may be involved in the early stages of cAMP sensing and subsequent chemotactic responses. It is a potential receptor for GABA and glutamate, potentially leading to the induction or inhibition of SDF-2 formation.
Database Links
Protein Families
G-protein coupled receptor 3 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of grlE in Dictyostelium discoideum?

grlE in Dictyostelium discoideum is classified as a G-protein-coupled seven transmembrane receptor (GPCR) belonging to family 3 GPCRs. The protein contains a signal sequence for membrane insertion at the N-terminus followed by a ligand-binding domain with homology to GABA B and glutamate metabotropic receptor domains. The seven-transmembrane region is positioned toward the C-terminus. Unlike glutamate metabotropic receptors in animals, grlE lacks the cysteine-rich domain necessary for forming stable dimers, a characteristic shared with GABA B receptors .

The full-length mature protein spans amino acids 28-816 and contains multiple functional domains that contribute to its signaling capabilities. The ligand-binding domain of grlE shows higher similarity to GABA B receptors than to glutamate metabotropic receptors, although the difference in similarities is relatively small .

What is the primary function of grlE in Dictyostelium development?

grlE functions as the GABA receptor in Dictyostelium discoideum, playing a crucial role in the terminal differentiation process during multicellular development. When prespore cells approach the top of the stalk in a Dictyostelium fruiting body, they rapidly encapsulate in response to the signaling peptide SDF-2. The GABA-grlE interaction is integral to this process .

Specifically, GABA induces the release of AcbA (the precursor of SDF-2) from prespore cells and also induces the exposure of the protease domain of TagC on the surface of prestalk cells where it can convert AcbA to SDF-2. The signal transduction pathway from GABA/grlE appears to be mediated by PI3 kinase and the PKB-related protein kinase PkbR1 .

Disruption of the grlE gene significantly impacts sporulation efficiency. While grlE-null cells can grow and proceed through morphogenesis normally, they produce less than a third as many viable spores as wild-type strains and do not produce SDF-2 activity in response to GABA .

How does the amino acid sequence of grlE contribute to its function?

The functional domains within the grlE amino acid sequence (816 amino acids in total) include:

  • Signal peptide (amino acids 1-27): Directs the protein to the membrane

  • Extracellular domain (N-terminal region): Contains the ligand-binding region that interacts with GABA

  • Seven transmembrane domains: Form the core structure common to all GPCRs

  • C-terminal region: Involved in G-protein interaction and downstream signaling

The specific amino acid sequence of the ligand-binding domain determines the selectivity for GABA over glutamate, though glutamate can act as a competitive inhibitor of GABA functions in Dictyostelium . The sequence is characterized by multiple conserved motifs typical of family 3 GPCRs, enabling proper folding and functionality of the receptor.

What are the recommended methods for expressing and purifying recombinant grlE protein?

Recombinant grlE can be effectively expressed in E. coli expression systems. For optimal expression and purification, the following methodology is recommended:

  • Expression System: Generate a construct containing the full-length mature grlE protein (amino acids 28-816) fused to an N-terminal His-tag for purification purposes .

  • Expression Conditions: Transform the construct into an appropriate E. coli strain optimized for membrane protein expression. Induce protein expression under controlled temperature and IPTG concentration.

  • Purification Protocol:

    • Lyse cells in appropriate buffer containing protease inhibitors

    • Isolate membrane fractions through differential centrifugation

    • Solubilize membrane proteins using mild detergents

    • Purify using nickel affinity chromatography targeting the His-tag

    • Further purify using size exclusion chromatography if needed

  • Storage and Handling: Store as lyophilized powder or in solution with 6% trehalose in Tris/PBS-based buffer at pH 8.0. For repeated use, prepare working aliquots and store at 4°C for up to one week. Avoid repeated freeze-thaw cycles by storing long-term aliquots at -20°C/-80°C .

  • Reconstitution: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal stability, add glycerol to a final concentration of 5-50% and prepare multiple small aliquots .

What approaches can be used to generate grlE knockout strains in Dictyostelium?

Homologous recombination has proven effective for generating grlE knockout strains. The recommended approach includes:

  • Construct Design: Create a disruption construct where a selectable marker (e.g., blasticidin resistance gene) is inserted near the start of the grlE coding sequence .

  • Transformation: Transform Dictyostelium cells with the linearized construct using standard electroporation methods or calcium phosphate precipitation.

  • Selection: Apply blasticidin selection to identify transformants containing the disrupted gene.

  • Verification: Confirm gene disruption through diagnostic PCR reactions that demonstrate replacement of the endogenous gene with the disrupted copy. The PCR product sizes should indicate successful insertion of the resistance cassette .

  • Phenotypic Analysis: Assess the knockout strains for developmental defects, focusing particularly on:

    • Fruiting body formation (morphology appears normal in grlE knockouts)

    • Spore viability (reduced to approximately one-third of wild-type levels)

    • SDF-2 production (absent in response to GABA in grlE knockouts)

This homologous recombination approach has been successfully implemented to study grlE function, revealing its critical role in GABA-mediated signaling during Dictyostelium development.

How does the signaling pathway downstream of grlE function in Dictyostelium?

The grlE signaling pathway in Dictyostelium involves several key components:

  • Ligand Binding: GABA binds to the extracellular domain of grlE, initiating the signaling cascade.

  • G-protein Coupling: As a GPCR, grlE activates heterotrimeric G-proteins upon ligand binding.

  • Downstream Effectors: The signal transduction pathway appears to be mediated by:

    • PI3 kinase activation

    • PKB-related protein kinase PkbR1 signaling

  • Convergence with SDF-2 Pathway: While the signal transduction pathway from SDF-2 is independent of the GABA/glutamate signal transduction pathway, the two pathways converge to control:

    • Release of AcbA from prespore cells

    • Exposure of TagC protease on prestalk cells

  • Functional Outcomes: This signaling cascade ultimately leads to:

    • Processing of AcbA to generate SDF-2

    • Terminal differentiation of prespore cells into mature spores

Interestingly, glutamate acts as a competitive inhibitor of GABA functions in Dictyostelium and can also inhibit induction of sporulation by SDF-2, suggesting complex regulatory control over this developmental pathway .

What methods can be used to analyze grlE-mediated GABA responses in Dictyostelium?

Several experimental approaches can be employed to analyze grlE-mediated GABA responses:

  • SDF-2 Production Assay:

    • Develop cells to the tight aggregate stage

    • Treat with GABA (optimal concentration: 1 nM)

    • Collect supernatants and measure SDF-2 activity using KP cells as indicators

    • Compare responses between wild-type and grlE-null strains

  • AcbA Release Measurement:

    • Develop cells to late culmination stage

    • Apply GABA treatments

    • Detect AcbA in supernatants using Western blotting or ELISA methods

    • Quantify differences in AcbA release between control and experimental conditions

  • TagC Exposure Analysis:

    • Use immunofluorescence to detect surface exposure of the TagC protease domain

    • Compare TagC localization in the presence and absence of GABA stimulation

    • Include grlE-null cells as negative controls

  • Competitive Inhibition Studies:

    • Perform dose-response experiments with GABA in the presence of varying concentrations of glutamate

    • Measure shifts in EC50 values to quantify competitive inhibition

    • Use this approach to characterize the pharmacology of the grlE receptor

  • PI3K/PkbR1 Activation Assays:

    • Monitor downstream signaling by assessing phosphorylation of PkbR1 following GABA treatment

    • Use specific inhibitors to confirm pathway components

    • Compare activation patterns between wild-type and mutant strains

These methodologies provide complementary information about the function and regulation of grlE-mediated signaling in Dictyostelium development.

How does grlE compare to other G protein-coupled receptors in Dictyostelium discoideum?

Dictyostelium discoideum possesses 15 genes encoding homologs of glutamate and GABA metabotropic receptors . Among these, grlE has several distinctive features:

  • Ligand Specificity: grlE is the only receptor showing significant similarity in the ligand binding domain to the GABA B family. The other 14 receptors show similarity primarily in the transmembrane and cytoplasmic G protein-binding regions rather than the ligand-binding domain .

  • Structural Comparison:

    • Like GABA B receptors, grlE lacks the cysteine-rich domain present in glutamate metabotropic receptors

    • Contains a signal sequence for membrane insertion at the N-terminus

    • Features the canonical seven-transmembrane region toward the C-terminus

  • Functional Divergence: While some G protein-coupled receptors in Dictyostelium (such as grlG) have evolved in relation to fruiting body formation and social behavior , grlE appears specifically dedicated to GABA-mediated terminal differentiation during development.

This comparative analysis suggests that while the Dictyostelium genome encodes multiple metabotropic receptor-like proteins, functional specialization has occurred, with grlE evolving specifically for GABA-mediated signaling during the culmination phase of development.

What evolutionary insights can be gained from studying grlE across different species?

The presence of GABA receptors in Dictyostelium provides fascinating evolutionary insights:

  • Ancient Signaling System: The presence of GABA/glutamate signaling in Dictyostelium suggests that these intercellular signals and their receptors evolved before the divergence of animals and social amoebae. This indicates that GABA is not only a neurotransmitter but also an ancient intercellular signal .

  • Receptor Conservation: While ionotropic GABA/glutamate receptors are absent in Dictyostelium, the presence of metabotropic receptors suggests the latter evolved earlier in eukaryotic history.

  • Functional Co-option: The utilization of GABA signaling for multicellular development in Dictyostelium versus primarily neuronal functions in animals represents an example of evolutionary co-option of signaling systems for different physiological roles.

  • Convergent Structural Solutions: Despite different biological contexts, the structural features of GABA receptors show remarkable conservation across evolutionarily distant organisms, suggesting constraints on receptor architecture for effective GABA binding and signaling.

This evolutionary perspective enhances our understanding of signaling system origins and highlights the value of Dictyostelium as a model for studying fundamental cellular processes with relevance across the eukaryotic domain.

What are common issues encountered when working with recombinant grlE and how can they be addressed?

IssuePotential CausesRecommended Solutions
Poor expression yieldToxicity to host cells
Protein misfolding
Codon bias
Use inducible systems with tight regulation
Optimize growth temperature (typically lower)
Use specialized host strains with rare codons
Protein insolubilityMembrane protein aggregation
Improper detergent selection
Screen multiple detergents (DDM, LDAO, etc.)
Add solubilizing agents during extraction
Consider fusion partners to enhance solubility
Rapid degradationProtease susceptibility
Inherent instability
Include multiple protease inhibitors
Maintain samples at 4°C during purification
Add stabilizing agents (glycerol, trehalose)
Loss of activityDenaturation during purification
Critical cofactors missing
Use milder purification conditions
Supplement buffers with GABA or analogs
Reconstitute in lipid bilayers to restore native environment
Aggregation after storageFreeze-thaw damage
Concentration too high
Add 6% trehalose as cryoprotectant
Store at -80°C in small single-use aliquots
Maintain protein below 1 mg/ml concentration

How can researchers verify the functional integrity of purified recombinant grlE?

To confirm that purified recombinant grlE maintains its native structure and functional properties, researchers should employ multiple complementary approaches:

  • Ligand Binding Assays:

    • Radioligand binding assays using tritiated GABA

    • Fluorescence-based binding assays with fluorescently labeled GABA analogs

    • Competition binding assays with glutamate to verify competitive inhibition properties

  • Structural Verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to confirm proper folding

    • Size exclusion chromatography to verify monodispersity

  • Functional Reconstitution:

    • Incorporation into liposomes or nanodiscs

    • G-protein activation assays using purified G-proteins

    • FRET-based conformational change detection upon ligand binding

  • Cell-Based Validation:

    • Complementation experiments in grlE-null Dictyostelium strains

    • Heterologous expression in mammalian cells coupled to downstream signaling readouts

    • Electrophysiological recordings in appropriate expression systems

  • Comparative Pharmacology:

    • Response to known GABA B receptor modulators

    • Differential effects of GABA versus glutamate

    • Dose-response relationships compared to native receptor

These validation approaches ensure that the recombinant protein retains the binding and signaling properties of the native grlE receptor, essential for meaningful biochemical and structural studies.

What are promising areas for future research on grlE in Dictyostelium discoideum?

Several promising research directions could significantly advance our understanding of grlE biology:

  • Structural Biology: Determine the three-dimensional structure of grlE using cryo-electron microscopy or X-ray crystallography to:

    • Elucidate the precise structural basis for GABA binding

    • Identify conformational changes upon ligand binding

    • Compare with mammalian GABA B receptor structures

  • Signaling Network Integration: Map the complete signaling network downstream of grlE activation, including:

    • Identification of all G-protein subunits that couple to grlE

    • Characterization of interactions with other developmental signaling pathways

    • Systems biology approaches to model receptor function in the context of development

  • Regulation of Receptor Function:

    • Investigate post-translational modifications of grlE

    • Determine if receptor dimerization or oligomerization occurs

    • Study trafficking and subcellular localization during different developmental stages

  • Evolutionary Significance:

    • Comparative analysis of grlE orthologs across social amoebae species

    • Investigation of GABA signaling in early-diverging eukaryotes

    • Reconstruction of the evolutionary history of GABA signaling systems

  • Therapeutic Relevance:

    • Exploration of grlE as a simplified model for understanding mammalian GABA B receptor function

    • Screening for novel modulators with potential applications in neuropharmacology

    • Investigation of conserved mechanisms that could inform human neurological disease research

These research directions would not only enhance our understanding of Dictyostelium biology but could also provide valuable insights into the evolution and function of GABA signaling across eukaryotes.

How might advanced techniques enhance our understanding of grlE biology?

Emerging technologies offer powerful new approaches to investigate grlE:

  • CRISPR-Cas9 Genome Editing:

    • Generate precise point mutations to map critical residues for ligand binding and signaling

    • Create fluorescent protein fusions at the endogenous locus for live imaging

    • Develop conditional knockouts to study temporal requirements for grlE function

  • Single-Cell RNA Sequencing:

    • Profile transcriptional responses to grlE activation at single-cell resolution

    • Identify cell-type specific effects during multicellular development

    • Map heterogeneity in receptor expression and response

  • Optogenetics and Chemogenetics:

    • Develop light-controlled or designer drug-controlled versions of grlE

    • Enable precise temporal control of receptor activation during development

    • Dissect the kinetics of signaling events in vivo

  • Cryo-Electron Tomography:

    • Visualize grlE in its native membrane environment

    • Study receptor clustering and organization at the cell surface

    • Examine conformational states under different conditions

  • Metabolomics and Lipidomics:

    • Investigate how grlE activation affects cellular metabolism

    • Identify lipid interactions that may modulate receptor function

    • Profile metabolic changes during GABA-induced terminal differentiation

These advanced techniques would provide unprecedented insights into the molecular mechanisms, cellular functions, and developmental roles of grlE in Dictyostelium, potentially revealing principles that extend to GABA signaling across eukaryotic life.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.